Recombinant Human C, His-tagged

Cat.No. : C-30019TH
Product Overview : Recombinant full length protein, corresponding to amino acids 1-126 of Human PGEA1 with an N terminal His tag. Observed mol wt: 23 kDa ;
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-126 a.a.
Description : Beta-catenin is a transcriptional activator and oncoprotein involved in the development of several cancers. The protein encoded by this gene interacts directly with the C-terminal region of beta-catenin, inhibiting oncogenic beta-catenin-mediated transcriptional activation by competing with transcription factors for binding to beta-catenin. Two transcript variants encoding different isoforms have been found for this gene.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 108 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MPFFGNTFSPKKTPPRKSASLSNLHSLDRSTREVELGLEY GSPTMNLAGQSLKFENGQWIAETGVSGGVDRREVQRLR RRNQQLEEENNLLRLKVDILLDMLSESTAESHLMEKELDELRISRKRK
Full Length : Full L.
Gene Name CBY1 chibby homolog 1 (Drosophila) [ Homo sapiens ]
Official Symbol CF8">C
Synonyms C; chib; C22orf2, chromosome 22 open reading frame 2 , PGEA1, PKD2 interactor, golgi and endoplasmic reticulum associated 1; protein chibby homolog 1; Cby; Chibby; PIGEA 14; PIGEA14;
Gene ID 25776
mRNA Refseq NM_001002880
Protein Refseq NP_001002880
MIM 607757
Uniprot ID Q9Y3M2
Chromosome Location 22q12
Pathway Regulation of Wnt-mediated beta catenin signaling and target gene transcription, organism-specific biosystem;
Function beta-catenin binding; identical protein binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C Products

Required fields are marked with *

My Review for All C Products

Required fields are marked with *

0

Inquiry Basket

cartIcon