Recombinant Human C, His-tagged
Cat.No. : | C-30019TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-126 of Human PGEA1 with an N terminal His tag. Observed mol wt: 23 kDa ; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-126 a.a. |
Description : | Beta-catenin is a transcriptional activator and oncoprotein involved in the development of several cancers. The protein encoded by this gene interacts directly with the C-terminal region of beta-catenin, inhibiting oncogenic beta-catenin-mediated transcriptional activation by competing with transcription factors for binding to beta-catenin. Two transcript variants encoding different isoforms have been found for this gene. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 108 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MPFFGNTFSPKKTPPRKSASLSNLHSLDRSTREVELGLEY GSPTMNLAGQSLKFENGQWIAETGVSGGVDRREVQRLR RRNQQLEEENNLLRLKVDILLDMLSESTAESHLMEKELDELRISRKRK |
Full Length : | Full L. |
Gene Name | CBY1 chibby homolog 1 (Drosophila) [ Homo sapiens ] |
Official Symbol | CF8">C |
Synonyms | C; chib; C22orf2, chromosome 22 open reading frame 2 , PGEA1, PKD2 interactor, golgi and endoplasmic reticulum associated 1; protein chibby homolog 1; Cby; Chibby; PIGEA 14; PIGEA14; |
Gene ID | 25776 |
mRNA Refseq | NM_001002880 |
Protein Refseq | NP_001002880 |
MIM | 607757 |
Uniprot ID | Q9Y3M2 |
Chromosome Location | 22q12 |
Pathway | Regulation of Wnt-mediated beta catenin signaling and target gene transcription, organism-specific biosystem; |
Function | beta-catenin binding; identical protein binding; protein binding; |
◆ Recombinant Proteins | ||
C-02H | Recombinant HBV Core Protein | +Inquiry |
C-1038R | Recombinant Rat C Protein | +Inquiry |
C-393V | Recombinant Measles Virus Non-Structural C Protein | +Inquiry |
HCV-01 | Recombinant HCV Core protein, His-tagged | +Inquiry |
C-655H | Recombinant HBV-C (isolate China/Tibet127/2002) C protein(1-183aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C Products
Required fields are marked with *
My Review for All C Products
Required fields are marked with *
0
Inquiry Basket