Recombinant Human C10orf111 Protein
Cat.No. : | C10orf111-414H |
Product Overview : | Human C10orf111 full-length ORF (ADZ15789.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Form : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Molecular Mass : | 17.1 kDa |
AA Sequence : | MESLQTPQHRENQDKREKEYGVKHMPMGNNAGNLEPEKRKAVRVALSSATAAQNIPSSVHCGCSKQWRLRLPSESLQSRGQVMKRPNNILKLRNLDLLIYPWPELRRRQVASDLMSLLLLPAFSGLTWAPFLFLFTYLPPFLNLLTVGFVSYFLV |
Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene Name | C10orf111 chromosome 10 open reading frame 111 [ Homo sapiens ] |
Official Symbol | C10orf111 |
Synonyms | bA455B2.4 |
Gene ID | 221060 |
mRNA Refseq | NM_153244.1 |
Protein Refseq | NP_694976.1 |
UniProt ID | Q8N326 |
◆ Recombinant Proteins | ||
RFL20396HF | Recombinant Full Length Human Uncharacterized Protein C10Orf111(C10Orf111) Protein, His-Tagged | +Inquiry |
C10orf111-414H | Recombinant Human C10orf111 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
C10orf111-8375HCL | Recombinant Human C10orf111 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C10orf111 Products
Required fields are marked with *
My Review for All C10orf111 Products
Required fields are marked with *