Recombinant Human C10orf111 Protein

Cat.No. : C10orf111-414H
Product Overview : Human C10orf111 full-length ORF (ADZ15789.1) recombinant protein without tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Form : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Molecular Mass : 17.1 kDa
AA Sequence : MESLQTPQHRENQDKREKEYGVKHMPMGNNAGNLEPEKRKAVRVALSSATAAQNIPSSVHCGCSKQWRLRLPSESLQSRGQVMKRPNNILKLRNLDLLIYPWPELRRRQVASDLMSLLLLPAFSGLTWAPFLFLFTYLPPFLNLLTVGFVSYFLV
Usage : Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene Name C10orf111 chromosome 10 open reading frame 111 [ Homo sapiens ]
Official Symbol C10orf111
Synonyms bA455B2.4
Gene ID 221060
mRNA Refseq NM_153244.1
Protein Refseq NP_694976.1
UniProt ID Q8N326

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C10orf111 Products

Required fields are marked with *

My Review for All C10orf111 Products

Required fields are marked with *

0
cart-icon
0
compare icon