Recombinant Human C10orf116 Protein, GST-tagged

Cat.No. : C10orf116-415H
Product Overview : Human C10orf116 full-length ORF (BAG34968.1, 1 a.a. - 76 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : APM2 gene is exclusively expressed in adipose tissue. Its function is currently unknown.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 34.76 kDa
AA Sequence : MASKGLQDLKQQVEGTAQEAVSAAGAAAQQVVDQATEAGQKAMDQLAKTTQETIDKTANQASDTFSGIGKKFGLLK
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C10orf116 chromosome 10 open reading frame 116 [ Homo sapiens ]
Official Symbol C10orf116
Synonyms C10ORF116; chromosome 10 open reading frame 116; adipose most abundant gene transcript 2 protein; adipose specific 2; APM2; apM-2; RP11-96C23.4;
Gene ID 10974
mRNA Refseq NM_006829
Protein Refseq NP_006820
UniProt ID Q15847

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C10orf116 Products

Required fields are marked with *

My Review for All C10orf116 Products

Required fields are marked with *

0
cart-icon
0
compare icon