Recombinant Human C11orf10 Protein, GST-tagged

• Cat.No.: C11orf10-457H
• Product Overview: Human C11orf10 full-length ORF (NP_055021.1, 1 a.a. - 79 a.a.) recombinant protein with GST tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 35.09 kDa
• AA Sequence: MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVASLFMGFGVLFLLLWVGIYV
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C11orf10 chromosome 11 open reading frame 10 [ Homo sapiens ]
• Official Symbol: C11orf10
• Synonyms: C11orf10
• Gene ID: 746
• mRNA Refseq: NM_014206.3
• Protein Refseq: NP_055021.1
• UniProt ID: P61165