Recombinant Human C11orf10 Protein, GST-tagged

Cat.No. : C11orf10-457H
Product Overview : Human C11orf10 full-length ORF (NP_055021.1, 1 a.a. - 79 a.a.) recombinant protein with GST tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 35.09 kDa
AA Sequence : MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVASLFMGFGVLFLLLWVGIYV
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C11orf10 chromosome 11 open reading frame 10 [ Homo sapiens ]
Official Symbol C11orf10
Synonyms C11orf10
Gene ID 746
mRNA Refseq NM_014206.3
Protein Refseq NP_055021.1
UniProt ID P61165

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C11orf10 Products

Required fields are marked with *

My Review for All C11orf10 Products

Required fields are marked with *

0
cart-icon