Recombinant Human C11orf67 Protein, GST-tagged

Cat.No. : C11orf67-480H
Product Overview : Human C11orf67 full-length ORF (BAB14963.1, 1 a.a. - 122 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 39.7 kDa
AA Sequence : MTSPEIASLSWGQMKVKGSNTTYKDCKVWPGGSRTWDWRETGTEHSPGVQPADVKEVVEKGVQTLVIGRGMSEALKVPSSTVEYLKKHGIDVRVLQTEQAVKEYNALVAQGVRVGGVFHSTC
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C11orf67 chromosome 11 open reading frame 67 [ Homo sapiens ]
Official Symbol C11orf67
Synonyms C11ORF67; chromosome 11 open reading frame 67; UPF0366 protein C11orf67; CK067; FLJ21035; PTD015; MGC3367;
Gene ID 28971
mRNA Refseq NM_024684
Protein Refseq NP_078960
UniProt ID Q9H7C9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C11orf67 Products

Required fields are marked with *

My Review for All C11orf67 Products

Required fields are marked with *

0
cart-icon
0
compare icon