Recombinant Human C11orf74 Protein, GST-tagged
Cat.No. : | C11orf74-485H |
Product Overview : | Human C11orf74 full-length ORF ( NP_620142.2, 1 a.a. - 221 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 51.8 kDa |
AA Sequence : | MSAHMSGLEIMDEDQLIKDVLDKFLNCHEQTYDEEFLNTFTHLSQEDHVSKRGVFGTDSSENIFTSAKVTHKNEADDYHLRNKTIFLRTSSQCLEEQVDNFLDLEDLDMDEEIKPQMSEDLLLLPGEVEQDVSTSIPSCIPFVAQPPTCEVKPKPSVKRMDKQTEEILGDEVQLFSLDEEFDYDNVMLTSKFSPAEIENIKELCKQQKRKDTSPDLEKSCD |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | C11orf74 chromosome 11 open reading frame 74 [ Homo sapiens ] |
Official Symbol | C11orf74 |
Synonyms | C11ORF74; chromosome 11 open reading frame 74; uncharacterized protein C11orf74; FLJ38678; HEPIS; |
Gene ID | 119710 |
mRNA Refseq | NM_138787 |
Protein Refseq | NP_620142 |
UniProt ID | Q86VG3 |
◆ Recombinant Proteins | ||
C11orf74-4293H | Recombinant Human C11orf74 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
C11orf74-485H | Recombinant Human C11orf74 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C11orf74-8335HCL | Recombinant Human C11orf74 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C11orf74 Products
Required fields are marked with *
My Review for All C11orf74 Products
Required fields are marked with *