Recombinant Human C12ORF5
| Cat.No. : | C12ORF5-30301TH |
| Product Overview : | Recombinant full length Human TIGAR fused to a 13-residue C-terminal peptide containing the TAT transduction domain ; 284 amino acids, 36kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 270 amino acids |
| Description : | This gene is regulated as part of the p53 tumor suppressor pathway and encodes a protein with sequence similarity to the bisphosphate domain of the glycolytic enzyme that degrades fructose-2,6-bisphosphate. The protein functions by blocking glycolysis and directing the pathway into the pentose phosphate shunt. Expression of this protein also protects cells from DNA damaging reactive oxygen species and provides some protection from DNA damage-induced apoptosis. The 12p13.32 region that includes this gene is paralogous to the 11q13.3 region. |
| Molecular Weight : | 36.000kDa inclusive of tags |
| Form : | Lyophilised |
| Purity : | >95% by SDS-PAGE |
| Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MARFALTVVRHGETRFNKEKIIQGQGVDEPLSETGFKQAA AAGIFLNNVKFTHAFSSDLMRTKQTMHGILERSKFCKDMT VKYDSRLRERKYGVVEGKALSELRAMAKAAREECPVFTPP GGETLDQVKMRGIDFFEFLCQLILKEADQKEQFSQGSPSN CLETSLAEIFPLGKNHSSKVNSDSGIPGLAASVLVVSHGA YMRSLFDYFLTDLKCSLPATLSRSELMSVTPNTGMSLFII NFEEGREVKPTVQCICMNLQDHLNGLTETRGGGYGRKKRR QRRR |
| Sequence Similarities : | Belongs to the phosphoglycerate mutase family. |
| Gene Name | C12orf5 chromosome 12 open reading frame 5 [ Homo sapiens ] |
| Official Symbol | C12ORF5 |
| Synonyms | C12ORF5; chromosome 12 open reading frame 5; probable fructose-2,6-bisphosphatase TIGAR; TIGAR; TP53 induced glycolysis and apoptosis regulator; |
| Gene ID | 57103 |
| mRNA Refseq | NM_020375 |
| Protein Refseq | NP_065108 |
| MIM | 610775 |
| Uniprot ID | Q9NQ88 |
| Chromosome Location | 12p13.32 |
| Pathway | Direct p53 effectors, organism-specific biosystem; Fructose and mannose metabolism, organism-specific biosystem; Fructose and mannose metabolism, conserved biosystem; |
| Function | fructose-2,6-bisphosphate 2-phosphatase activity; hydrolase activity; |
| ◆ Recombinant Proteins | ||
| C12ORF5-30300TH | Recombinant Human C12ORF5, His-tagged | +Inquiry |
| C12orf5-3365H | Recombinant Human C12orf5 protein, His-tagged | +Inquiry |
| C12orf5-1755HF | Recombinant Full Length Human C12orf5 Protein, GST-tagged | +Inquiry |
| C12ORF5-30301TH | Recombinant Human C12ORF5 | +Inquiry |
| C12orf5-508H | Recombinant Human C12orf5 Protein, TAT-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| C12orf5-8316HCL | Recombinant Human C12orf5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C12ORF5 Products
Required fields are marked with *
My Review for All C12ORF5 Products
Required fields are marked with *
