Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human C12ORF5

Cat.No. : C12ORF5-30301TH
Product Overview : Recombinant full length Human TIGAR fused to a 13-residue C-terminal peptide containing the TAT transduction domain ; 284 amino acids, 36kDa.
  • Specification
  • Gene Information
  • Related Products
Description : This gene is regulated as part of the p53 tumor suppressor pathway and encodes a protein with sequence similarity to the bisphosphate domain of the glycolytic enzyme that degrades fructose-2,6-bisphosphate. The protein functions by blocking glycolysis and directing the pathway into the pentose phosphate shunt. Expression of this protein also protects cells from DNA damaging reactive oxygen species and provides some protection from DNA damage-induced apoptosis. The 12p13.32 region that includes this gene is paralogous to the 11q13.3 region.
Protein length : 270 amino acids
Molecular Weight : 36.000kDa inclusive of tags
Source : E. coli
Form : Lyophilised
Purity : >95% by SDS-PAGE
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MARFALTVVRHGETRFNKEKIIQGQGVDEPLSETGFKQAA AAGIFLNNVKFTHAFSSDLMRTKQTMHGILERSKFCKDMT VKYDSRLRERKYGVVEGKALSELRAMAKAAREECPVFTPP GGETLDQVKMRGIDFFEFLCQLILKEADQKEQFSQGSPSN CLETSLAEIFPLGKNHSSKVNSDSGIPGLAASVLVVSHGA YMRSLFDYFLTDLKCSLPATLSRSELMSVTPNTGMSLFII NFEEGREVKPTVQCICMNLQDHLNGLTETRGGGYGRKKRR QRRR
Sequence Similarities : Belongs to the phosphoglycerate mutase family.
Gene Name : C12orf5 chromosome 12 open reading frame 5 [ Homo sapiens ]
Official Symbol : C12ORF5
Synonyms : C12ORF5; chromosome 12 open reading frame 5; probable fructose-2,6-bisphosphatase TIGAR; TIGAR; TP53 induced glycolysis and apoptosis regulator;
Gene ID : 57103
mRNA Refseq : NM_020375
Protein Refseq : NP_065108
MIM : 610775
Uniprot ID : Q9NQ88
Chromosome Location : 12p13.32
Pathway : Direct p53 effectors, organism-specific biosystem; Fructose and mannose metabolism, organism-specific biosystem; Fructose and mannose metabolism, conserved biosystem;
Function : fructose-2,6-bisphosphate 2-phosphatase activity; hydrolase activity;

Products Types

◆ Recombinant Protein
C12orf5-509H Recombinant Human C12orf5 Protein, GST-tagged +Inquiry
C12orf5-508H Recombinant Human C12orf5 Protein, TAT-tagged +Inquiry
C12ORF5-30300TH Recombinant Human C12ORF5, His-tagged +Inquiry
C12orf5-3371H Recombinant Human Chromosome 12 Open Reading Frame 5, His-tagged +Inquiry

See All C12ORF5 Recombinant Protein

◆ Lysates
C12orf5-8316HCL Recombinant Human C12orf5 293 Cell Lysate +Inquiry

See All C12ORF5 Lysates

Related Gene

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends