Recombinant Human C12orf54 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: C12orf54-5411H
• Product Overview: C12orf54 MS Standard C13 and N15-labeled recombinant protein (NP_689532) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: C12orf54 (Chromosome 12 Open Reading Frame 54) is a Protein Coding gene. Diseases associated with C12orf54 include Fanconi Anemia, Complementation Group A.
• Molecular Mass: 14.5 kDa
• AA Sequence: MAQHPCQDQEQKVEMTSKQQRSTSIEETMRPQEKQVTITETLWDQVLTVFKDIQKELQEDARIRGMSNCSMTPMTSAPRTGSIRPPDSLMTPKLRRLQFSSGEQPSGGRIHNLKTQLFSQSAYYPGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: C12orf54 chromosome 12 open reading frame 54 [ Homo sapiens (human) ]
• Official Symbol: C12orf54
• Synonyms: C12ORF54; chromosome 12 open reading frame 54; uncharacterized protein C12orf54; MGC35033; HSD-29; HSD-30
• Gene ID: 121273
• mRNA Refseq: NM_152319
• Protein Refseq: NP_689532
• UniProt ID: Q6X4T0