Recombinant Human C12orf54 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | C12orf54-5411H |
Product Overview : | C12orf54 MS Standard C13 and N15-labeled recombinant protein (NP_689532) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | C12orf54 (Chromosome 12 Open Reading Frame 54) is a Protein Coding gene. Diseases associated with C12orf54 include Fanconi Anemia, Complementation Group A. |
Molecular Mass : | 14.5 kDa |
AA Sequence : | MAQHPCQDQEQKVEMTSKQQRSTSIEETMRPQEKQVTITETLWDQVLTVFKDIQKELQEDARIRGMSNCSMTPMTSAPRTGSIRPPDSLMTPKLRRLQFSSGEQPSGGRIHNLKTQLFSQSAYYPGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | C12orf54 chromosome 12 open reading frame 54 [ Homo sapiens (human) ] |
Official Symbol | C12orf54 |
Synonyms | C12ORF54; chromosome 12 open reading frame 54; uncharacterized protein C12orf54; MGC35033; HSD-29; HSD-30; |
Gene ID | 121273 |
mRNA Refseq | NM_152319 |
Protein Refseq | NP_689532 |
UniProt ID | Q6X4T0 |
◆ Recombinant Proteins | ||
C12orf54-5411H | Recombinant Human C12orf54 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
C12orf54-8314HCL | Recombinant Human C12orf54 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C12orf54 Products
Required fields are marked with *
My Review for All C12orf54 Products
Required fields are marked with *