Recombinant Human C12orf54 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : C12orf54-5411H
Product Overview : C12orf54 MS Standard C13 and N15-labeled recombinant protein (NP_689532) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : C12orf54 (Chromosome 12 Open Reading Frame 54) is a Protein Coding gene. Diseases associated with C12orf54 include Fanconi Anemia, Complementation Group A.
Molecular Mass : 14.5 kDa
AA Sequence : MAQHPCQDQEQKVEMTSKQQRSTSIEETMRPQEKQVTITETLWDQVLTVFKDIQKELQEDARIRGMSNCSMTPMTSAPRTGSIRPPDSLMTPKLRRLQFSSGEQPSGGRIHNLKTQLFSQSAYYPGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name C12orf54 chromosome 12 open reading frame 54 [ Homo sapiens (human) ]
Official Symbol C12orf54
Synonyms C12ORF54; chromosome 12 open reading frame 54; uncharacterized protein C12orf54; MGC35033; HSD-29; HSD-30;
Gene ID 121273
mRNA Refseq NM_152319
Protein Refseq NP_689532
UniProt ID Q6X4T0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C12orf54 Products

Required fields are marked with *

My Review for All C12orf54 Products

Required fields are marked with *

0
cart-icon