Recombinant Human C14orf177 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: C14orf177-1943H
• Product Overview: C14orf177 MS Standard C13 and N15-labeled recombinant protein (NP_872366) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: C14orf177 (Chromosome 14 Putative Open Reading Frame 177) is an RNA Gene, and is affiliated with the lncRNA class. Diseases associated with C14orf177 include Bardet-Biedl Syndrome 12.
• Molecular Mass: 13.9 kDa
• AA Sequence: MHRKEPGARLEATRGAARPHKQGTKPMITRPSVSQLGEGKCPSSQHLQSLRHNKQHALTLTKARCCGECSTCFCTEEKSECQRHEETSPGSCNHQIMSASTISAFCATPRFKQLFKGTVEQMSQMTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: C14orf177 chromosome 14 open reading frame 177 [ Homo sapiens (human) ]
• Official Symbol: C14orf177
• Synonyms: C14ORF177; chromosome 14 open reading frame 177; putative uncharacterized protein C14orf177; FLJ25773
• Gene ID: 283598
• mRNA Refseq: NM_182560
• Protein Refseq: NP_872366
• UniProt ID: Q52M58