Recombinant Human C14orf177 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : C14orf177-1943H
Product Overview : C14orf177 MS Standard C13 and N15-labeled recombinant protein (NP_872366) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : C14orf177 (Chromosome 14 Putative Open Reading Frame 177) is an RNA Gene, and is affiliated with the lncRNA class. Diseases associated with C14orf177 include Bardet-Biedl Syndrome 12.
Molecular Mass : 13.9 kDa
AA Sequence : MHRKEPGARLEATRGAARPHKQGTKPMITRPSVSQLGEGKCPSSQHLQSLRHNKQHALTLTKARCCGECSTCFCTEEKSECQRHEETSPGSCNHQIMSASTISAFCATPRFKQLFKGTVEQMSQMTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name C14orf177 chromosome 14 open reading frame 177 [ Homo sapiens (human) ]
Official Symbol C14orf177
Synonyms C14ORF177; chromosome 14 open reading frame 177; putative uncharacterized protein C14orf177; FLJ25773;
Gene ID 283598
mRNA Refseq NM_182560
Protein Refseq NP_872366
UniProt ID Q52M58

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C14orf177 Products

Required fields are marked with *

My Review for All C14orf177 Products

Required fields are marked with *

0
cart-icon