Recombinant Human C14orf177 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | C14orf177-1943H |
Product Overview : | C14orf177 MS Standard C13 and N15-labeled recombinant protein (NP_872366) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | C14orf177 (Chromosome 14 Putative Open Reading Frame 177) is an RNA Gene, and is affiliated with the lncRNA class. Diseases associated with C14orf177 include Bardet-Biedl Syndrome 12. |
Molecular Mass : | 13.9 kDa |
AA Sequence : | MHRKEPGARLEATRGAARPHKQGTKPMITRPSVSQLGEGKCPSSQHLQSLRHNKQHALTLTKARCCGECSTCFCTEEKSECQRHEETSPGSCNHQIMSASTISAFCATPRFKQLFKGTVEQMSQMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | C14orf177 chromosome 14 open reading frame 177 [ Homo sapiens (human) ] |
Official Symbol | C14orf177 |
Synonyms | C14ORF177; chromosome 14 open reading frame 177; putative uncharacterized protein C14orf177; FLJ25773; |
Gene ID | 283598 |
mRNA Refseq | NM_182560 |
Protein Refseq | NP_872366 |
UniProt ID | Q52M58 |
◆ Recombinant Proteins | ||
C14orf177-1943H | Recombinant Human C14orf177 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
C14orf177-612H | Recombinant Human C14orf177 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C14orf177-8279HCL | Recombinant Human C14orf177 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C14orf177 Products
Required fields are marked with *
My Review for All C14orf177 Products
Required fields are marked with *