Recombinant Human C14orf178 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | C14orf178-4952H |
Product Overview : | C14orf178 MS Standard C13 and N15-labeled recombinant protein (NP_777603) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | C14orf178 (Chromosome 14 Open Reading Frame 178) is an RNA Gene, and is affiliated with the lncRNA class. Diseases associated with C14orf178 include Visual Cortex Disease and Visual Pathway Disease. An important paralog of this gene is GSDMD. |
Molecular Mass : | 13.2 kDa |
AA Sequence : | MGREMKKTGTPRPFRIEDPNQQPTWHDQPEMGSHYFAQAGLELLGSSNPPASASQSAGITGVSHCARPGEHDLNHTVFQVKDSTFLRHLESDRPEFKSCLPPHFTEPSVSLSTSEGCEDAMGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | C14orf178 chromosome 14 open reading frame 178 [ Homo sapiens (human) ] |
Official Symbol | C14orf178 |
Synonyms | C14orf178; chromosome 14 open reading frame 178; uncharacterized protein C14orf178; FLJ25976; MGC129942 |
Gene ID | 283579 |
mRNA Refseq | NM_174943 |
Protein Refseq | NP_777603 |
UniProt ID | Q8N769 |
◆ Recombinant Proteins | ||
C14orf178-4952H | Recombinant Human C14orf178 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
C14orf178-626H | Recombinant Human C14orf178 Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C14orf178 Products
Required fields are marked with *
My Review for All C14orf178 Products
Required fields are marked with *