Recombinant Human C14orf178 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : C14orf178-4952H
Product Overview : C14orf178 MS Standard C13 and N15-labeled recombinant protein (NP_777603) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : C14orf178 (Chromosome 14 Open Reading Frame 178) is an RNA Gene, and is affiliated with the lncRNA class. Diseases associated with C14orf178 include Visual Cortex Disease and Visual Pathway Disease. An important paralog of this gene is GSDMD.
Molecular Mass : 13.2 kDa
AA Sequence : MGREMKKTGTPRPFRIEDPNQQPTWHDQPEMGSHYFAQAGLELLGSSNPPASASQSAGITGVSHCARPGEHDLNHTVFQVKDSTFLRHLESDRPEFKSCLPPHFTEPSVSLSTSEGCEDAMGTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name C14orf178 chromosome 14 open reading frame 178 [ Homo sapiens (human) ]
Official Symbol C14orf178
Synonyms C14orf178; chromosome 14 open reading frame 178; uncharacterized protein C14orf178; FLJ25976; MGC129942
Gene ID 283579
mRNA Refseq NM_174943
Protein Refseq NP_777603
UniProt ID Q8N769

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C14orf178 Products

Required fields are marked with *

My Review for All C14orf178 Products

Required fields are marked with *

0
cart-icon
0
compare icon