Recombinant Human C15orf40 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: C15orf40-2976H
• Product Overview: C15orf40 MS Standard C13 and N15-labeled recombinant protein (NP_653198) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Belongs to the UPF0235 family.
• Molecular Mass: 13.3 kDa
• AA Sequence: MPKKAGATTKGKSQSKEPERPLPPLGPVAVDPKGCVTIAIHAKPGSKQNAVTDLTAEAVNVAIAAPPSEGEANAELCRYLSKVLELRKSDVVLDKGGKSREKVVKLLASTTPEEILEKLKKEAKKTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: C15orf40 chromosome 15 open reading frame 40 [ Homo sapiens (human) ]
• Official Symbol: C15orf40
• Synonyms: C15ORF40; chromosome 15 open reading frame 40; UPF0235 protein C15orf40; MGC29937; FLJ33606
• Gene ID: 123207
• mRNA Refseq: NM_144597
• Protein Refseq: NP_653198
• UniProt ID: Q8WUR7