Recombinant Human C15orf40 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : C15orf40-2976H
Product Overview : C15orf40 MS Standard C13 and N15-labeled recombinant protein (NP_653198) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Belongs to the UPF0235 family.
Molecular Mass : 13.3 kDa
AA Sequence : MPKKAGATTKGKSQSKEPERPLPPLGPVAVDPKGCVTIAIHAKPGSKQNAVTDLTAEAVNVAIAAPPSEGEANAELCRYLSKVLELRKSDVVLDKGGKSREKVVKLLASTTPEEILEKLKKEAKKTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name C15orf40 chromosome 15 open reading frame 40 [ Homo sapiens (human) ]
Official Symbol C15orf40
Synonyms C15ORF40; chromosome 15 open reading frame 40; UPF0235 protein C15orf40; MGC29937; FLJ33606;
Gene ID 123207
mRNA Refseq NM_144597
Protein Refseq NP_653198
UniProt ID Q8WUR7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C15orf40 Products

Required fields are marked with *

My Review for All C15orf40 Products

Required fields are marked with *

0
cart-icon