Recombinant Human C16orf45 protein, GST-tagged
Cat.No. : | C16orf45-301627H |
Product Overview : | Recombinant Human C16orf45 (147-204 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Glu147-Met204 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | EMADFLRIKLKPLDKVTKSPASSRAEKKAEPPPSKPTVAKTGLALIKDCCGATQCNIM |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | C16orf45 chromosome 16 open reading frame 45 [ Homo sapiens ] |
Official Symbol | C16orf45 |
Synonyms | C16ORF45; chromosome 16 open reading frame 45; uncharacterized protein C16orf45; FLJ32618; |
Gene ID | 89927 |
mRNA Refseq | NM_001142469 |
Protein Refseq | NP_001135941 |
UniProt ID | Q96MC5 |
◆ Recombinant Proteins | ||
C16orf45-609H | Recombinant Human C16orf45 Protein, MYC/DDK-tagged | +Inquiry |
C16orf45-301627H | Recombinant Human C16orf45 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C16orf45-8256HCL | Recombinant Human C16orf45 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C16orf45 Products
Required fields are marked with *
My Review for All C16orf45 Products
Required fields are marked with *
0
Inquiry Basket