Recombinant Human C17orf102 Protein, GST-tagged

• Cat.No.: C17orf102-4345H
• Product Overview: Human FLJ44815 full-length ORF (BAC86680.1, 1 a.a. - 167 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: C17orf102 (Chromosome 17 Open Reading Frame 102) is a Protein Coding gene.
• Molecular Mass: 44.3 kDa
• AA Sequence: MFDFSFPTPASAGTRMGPASCGGRSLHLPQLRFSRVDATAVTDVPFQRMHAPHRAPEVFCSRSSRGAGRGHPTPTPRVRWALAGNQPRCCAQLLSGRRGSGAQLRAGWVRGPAVGNLFILLLGKEDGEEEGTVLSYSSMVHISNITGIVGTTVSKTKPALVLMELTF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C17orf102 chromosome 17 open reading frame 102 [ Homo sapiens (human) ]
• Official Symbol: C17orf102
• Synonyms: C17orf102; chromosome 17 open reading frame 102; uncharacterized protein C17orf102; Chromosome 17 Open Reading Frame 102
• Gene ID: 400591
• mRNA Refseq: NM_207454
• Protein Refseq: NP_997337
• UniProt ID: A2RUQ5