Recombinant Full Length Human C17orf102 Protein, GST-tagged
Cat.No. : | C17orf102-4919HF |
Product Overview : | Human FLJ44815 full-length ORF (BAC86680.1, 1 a.a. - 167 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 167 amino acids |
Description : | C17orf102 (Chromosome 17 Open Reading Frame 102) is a Protein Coding gene. |
Molecular Mass : | 44.3 kDa |
AA Sequence : | MFDFSFPTPASAGTRMGPASCGGRSLHLPQLRFSRVDATAVTDVPFQRMHAPHRAPEVFCSRSSRGAGRGHPTPTPRVRWALAGNQPRCCAQLLSGRRGSGAQLRAGWVRGPAVGNLFILLLGKEDGEEEGTVLSYSSMVHISNITGIVGTTVSKTKPALVLMELTF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | C17orf102 chromosome 17 open reading frame 102 [ Homo sapiens (human) ] |
Official Symbol | C17orf102 |
Synonyms | C17orf102; chromosome 17 open reading frame 102; uncharacterized protein C17orf102; Chromosome 17 Open Reading Frame 102 |
Gene ID | 400591 |
mRNA Refseq | NM_207454 |
Protein Refseq | NP_997337 |
UniProt ID | A2RUQ5 |
◆ Recombinant Proteins | ||
C17orf102-4345H | Recombinant Human C17orf102 Protein, GST-tagged | +Inquiry |
C17orf102-4919HF | Recombinant Full Length Human C17orf102 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C17orf102-8242HCL | Recombinant Human C17orf102 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C17orf102 Products
Required fields are marked with *
My Review for All C17orf102 Products
Required fields are marked with *