Recombinant Full Length Human C17orf102 Protein, GST-tagged
| Cat.No. : | C17orf102-4919HF | 
| Product Overview : | Human FLJ44815 full-length ORF (BAC86680.1, 1 a.a. - 167 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 167 amino acids | 
| Description : | C17orf102 (Chromosome 17 Open Reading Frame 102) is a Protein Coding gene. | 
| Molecular Mass : | 44.3 kDa | 
| AA Sequence : | MFDFSFPTPASAGTRMGPASCGGRSLHLPQLRFSRVDATAVTDVPFQRMHAPHRAPEVFCSRSSRGAGRGHPTPTPRVRWALAGNQPRCCAQLLSGRRGSGAQLRAGWVRGPAVGNLFILLLGKEDGEEEGTVLSYSSMVHISNITGIVGTTVSKTKPALVLMELTF | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array  | 
                                
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | C17orf102 chromosome 17 open reading frame 102 [ Homo sapiens (human) ] | 
| Official Symbol | C17orf102 | 
| Synonyms | C17orf102; chromosome 17 open reading frame 102; uncharacterized protein C17orf102; Chromosome 17 Open Reading Frame 102 | 
| Gene ID | 400591 | 
| mRNA Refseq | NM_207454 | 
| Protein Refseq | NP_997337 | 
| UniProt ID | A2RUQ5 | 
| ◆ Recombinant Proteins | ||
| C17orf102-4345H | Recombinant Human C17orf102 Protein, GST-tagged | +Inquiry | 
| C17orf102-4919HF | Recombinant Full Length Human C17orf102 Protein, GST-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| C17orf102-8242HCL | Recombinant Human C17orf102 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All C17orf102 Products
Required fields are marked with *
My Review for All C17orf102 Products
Required fields are marked with *
  
        
    
      
            