Recombinant Human C17orf80 protein, GST-tagged

Cat.No. : C17orf80-301298H
Product Overview : Recombinant Human C17orf80 (35-261 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Ile35-Val261
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : IPTDQKVYQSKPATLPRAKKMKGPIKDLIKAKGKELETENEERNSKLVVDKPEQTVKTFPLPAVGLERAATTKADKDIKNPIQPSFKMLKNTKPMTTFQEETKAQFYASEKTSPKRELAKDLPKSGESRCNPSEAGASLLVGSIEPSLSNQDRKYSSTLPNDVQTTSGDLKLDKIDPQRQELLVKLLDVPTGDCHISPKNVSDGVKRVRTLLSNERDSKGRDHLSGV
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name C17orf80 chromosome 17 open reading frame 80 [ Homo sapiens ]
Official Symbol C17orf80
Synonyms C17ORF80; chromosome 17 open reading frame 80; uncharacterized protein C17orf80; FLJ20721; HLC 8; MIG3; migration inducing protein 3; SPEP1; sperm expressed protein 1; sperm-expressed protein 1; migration-inducing protein 3; lung cancer-related protein 8; human lung cancer oncogene 8 protein; cell migration-inducing gene 3 protein; HLC-8;
Gene ID 55028
mRNA Refseq NM_001100621
Protein Refseq NP_001094091
UniProt ID Q9BSJ5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C17orf80 Products

Required fields are marked with *

My Review for All C17orf80 Products

Required fields are marked with *

0
cart-icon