Recombinant Human C17orf80 protein, GST-tagged

• Cat.No.: C17orf80-301298H
• Product Overview: Recombinant Human C17orf80 (35-261 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Ile35-Val261
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: IPTDQKVYQSKPATLPRAKKMKGPIKDLIKAKGKELETENEERNSKLVVDKPEQTVKTFPLPAVGLERAATTKADKDIKNPIQPSFKMLKNTKPMTTFQEETKAQFYASEKTSPKRELAKDLPKSGESRCNPSEAGASLLVGSIEPSLSNQDRKYSSTLPNDVQTTSGDLKLDKIDPQRQELLVKLLDVPTGDCHISPKNVSDGVKRVRTLLSNERDSKGRDHLSGV
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: C17orf80 chromosome 17 open reading frame 80 [ Homo sapiens ]
• Official Symbol: C17orf80
• Synonyms: C17ORF80; chromosome 17 open reading frame 80; uncharacterized protein C17orf80; FLJ20721; HLC 8; MIG3; migration inducing protein 3; SPEP1; sperm expressed protein 1; sperm-expressed protein 1; migration-inducing protein 3; lung cancer-related protein 8; human lung cancer oncogene 8 protein; cell migration-inducing gene 3 protein; HLC-8
• Gene ID: 55028
• mRNA Refseq: NM_001100621
• Protein Refseq: NP_001094091
• UniProt ID: Q9BSJ5