Recombinant Human C18orf32 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : C18orf32-1311H
Product Overview : C18orf32 MS Standard C13 and N15-labeled recombinant protein (NP_001030177) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : C18orf32 (Chromosome 18 Open Reading Frame 32) is a Protein Coding gene. Diseases associated with C18orf32 include Agnathia-Otocephaly Complex. Gene Ontology (GO) annotations related to this gene include obsolete signal transducer activity and structural constituent of ribosome.
Molecular Mass : 8.7 kDa
AA Sequence : MVCIPCIVIPVLLWIYKKFLEPYIYPLVSPFVSRIWPKKAIQESNDTNKGKVNFKGADMNGLPTKGPTEICDKKKDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name C18orf32 chromosome 18 open reading frame 32 [ Homo sapiens (human) ]
Official Symbol C18orf32
Synonyms C18orf32; chromosome 18 open reading frame 32; UPF0729 protein C18orf32; putative NF-kappa-B-activating protein 200; putative NFkB activating protein;
Gene ID 497661
mRNA Refseq NM_001035005
Protein Refseq NP_001030177
UniProt ID Q8TCD1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C18orf32 Products

Required fields are marked with *

My Review for All C18orf32 Products

Required fields are marked with *

0
cart-icon