Recombinant Human C18orf32 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | C18orf32-1311H |
Product Overview : | C18orf32 MS Standard C13 and N15-labeled recombinant protein (NP_001030177) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | C18orf32 (Chromosome 18 Open Reading Frame 32) is a Protein Coding gene. Diseases associated with C18orf32 include Agnathia-Otocephaly Complex. Gene Ontology (GO) annotations related to this gene include obsolete signal transducer activity and structural constituent of ribosome. |
Molecular Mass : | 8.7 kDa |
AA Sequence : | MVCIPCIVIPVLLWIYKKFLEPYIYPLVSPFVSRIWPKKAIQESNDTNKGKVNFKGADMNGLPTKGPTEICDKKKDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | C18orf32 chromosome 18 open reading frame 32 [ Homo sapiens (human) ] |
Official Symbol | C18orf32 |
Synonyms | C18orf32; chromosome 18 open reading frame 32; UPF0729 protein C18orf32; putative NF-kappa-B-activating protein 200; putative NFkB activating protein; |
Gene ID | 497661 |
mRNA Refseq | NM_001035005 |
Protein Refseq | NP_001030177 |
UniProt ID | Q8TCD1 |
◆ Recombinant Proteins | ||
C18orf32-1311H | Recombinant Human C18orf32 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
C18orf32-8220HCL | Recombinant Human C18orf32 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C18orf32 Products
Required fields are marked with *
My Review for All C18orf32 Products
Required fields are marked with *