Recombinant Human C19orf25 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | C19orf25-4982H |
Product Overview : | C19orf25 MS Standard C13 and N15-labeled recombinant protein (NP_689695) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | C19orf25 (Chromosome 19 Open Reading Frame 25) is a Protein Coding gene. |
Molecular Mass : | 12.7 kDa |
AA Sequence : | MGSKAKKRVLLPTRPAPPTVEQILEDVRGAPAEDPVFTILAPEDPPVPFRMMEDAEAPGEQLYQQSRAYVAANQRLQQAGNVPRLPPQADLSGPAGLGSAQGGLHPGFPWGSVGPRLAFTGSQPTWVLTQAPLLMLGLRFIRRLIHAELVGPTQLAPSCVTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | C19orf25 chromosome 19 open reading frame 25 [ Homo sapiens (human) ] |
Official Symbol | C19orf25 |
Synonyms | C19orf25; chromosome 19 open reading frame 25; UPF0449 protein C19orf25 |
Gene ID | 148223 |
mRNA Refseq | NM_152482 |
Protein Refseq | NP_689695 |
UniProt ID | Q9UFG5 |
◆ Recombinant Proteins | ||
C19orf25-4982H | Recombinant Human C19orf25 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
C19orf25-91HCL | Recombinant Human C19orf25 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C19orf25 Products
Required fields are marked with *
My Review for All C19orf25 Products
Required fields are marked with *