Recombinant Human C19orf40 protein, His-tagged
Cat.No. : | C19orf40-2742H |
Product Overview : | Recombinant Human C19orf40 protein(1-215 aa), fused to His tag, was expressed in E. coli. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-215 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MEKNPPDDTGPVHVPLGHIVANEKWRGSQLAQEMQGKIKLIFEDGLTPDFYLSNRCCILYVTEADLVAGNGYRKRLVRVRNSNNLKGIVVVEKTRMSEQYFPALQKFTVLDLGMVLLPVASQMEASCLVIQLVQEQTKEPSKNPLLGKKRALLLSEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQIHAFFTQPR |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | C19orf40 chromosome 19 open reading frame 40 [ Homo sapiens ] |
Official Symbol | C19orf40 |
Synonyms | C19ORF40; chromosome 19 open reading frame 40; Fanconi anemia-associated protein of 24 kDa; FAAP24; Fanconi anemia associated protein; 24kDa; FLJ46828; MGC32020; Fanconi anemia-associated protein, 24 kDa; |
Gene ID | 91442 |
mRNA Refseq | NM_152266 |
Protein Refseq | NP_689479 |
MIM | 610884 |
UniProt ID | Q9BTP7 |
◆ Recombinant Proteins | ||
C19orf40-2742H | Recombinant Human C19orf40 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C19orf40-8207HCL | Recombinant Human C19orf40 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C19orf40 Products
Required fields are marked with *
My Review for All C19orf40 Products
Required fields are marked with *