Recombinant Human C19ORF48 Protein (1-117 aa), GST-tagged

• Cat.No.: C19ORF48-2129H
• Product Overview: Recombinant Human C19ORF48 Protein (1-117 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Full Length.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-117 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 40.1 kDa
• AA Sequence: MTVLEAVLEIQAITGSRLLSMVPGPARPPGSCWDPTQCTRTWLLSHTPRRRWISGLPRASCRLGEEPPPLPYCDQAYGEELSIRHRETWAWLSRTDTAWPGAPGVKQARILGELLLV
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: C19orf48 chromosome 19 open reading frame 48 [ Homo sapiens (human) ]
• Official Symbol: C19ORF48
• Synonyms: C19orf48; Multidrug resistance-related protein
• Gene ID: 84798
• mRNA Refseq: NM_001290149
• Protein Refseq: NP_001277078
• UniProt ID: Q6RUI8