Recombinant Human C19ORF48 Protein (1-117 aa), GST-tagged
Cat.No. : | C19ORF48-2129H |
Product Overview : | Recombinant Human C19ORF48 Protein (1-117 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-117 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 40.1 kDa |
AA Sequence : | MTVLEAVLEIQAITGSRLLSMVPGPARPPGSCWDPTQCTRTWLLSHTPRRRWISGLPRASCRLGEEPPPLPYCDQAYGEELSIRHRETWAWLSRTDTAWPGAPGVKQARILGELLLV |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | C19orf48 chromosome 19 open reading frame 48 [ Homo sapiens (human) ] |
Official Symbol | C19ORF48 |
Synonyms | C19orf48; Multidrug resistance-related protein; |
Gene ID | 84798 |
mRNA Refseq | NM_001290149 |
Protein Refseq | NP_001277078 |
UniProt ID | Q6RUI8 |
◆ Recombinant Proteins | ||
C19ORF48-2129H | Recombinant Human C19ORF48 Protein (1-117 aa), GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C19orf48-8205HCL | Recombinant Human C19orf48 293 Cell Lysate | +Inquiry |
C19orf48-8204HCL | Recombinant Human C19orf48 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C19ORF48 Products
Required fields are marked with *
My Review for All C19ORF48 Products
Required fields are marked with *