Recombinant Human C1orf131 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : C1orf131-3831H
Product Overview : C1orf131 MS Standard C13 and N15-labeled recombinant protein (NP_689592) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : C1orf131 (Chromosome 1 Open Reading Frame 131) is a Protein Coding gene.
Molecular Mass : 32.5 kDa
AA Sequence : MRVDSSADPTMSQEQGPGSSTPPSSPTLLDALLQNLYDFGGTEGETEQKKIIKKRENKKRDVMASAALAAEPSPLPGSLIRGQRKSASSFFKELREERHCAPSGTPTGPEILAAAVPPSSLKNNREQVEVVEFHSNKKRKLTPDHNKNTKANPSVLERDVDTQEFNLEKARLEVHRFGITGYGKGKERILEQERAIMLGAKPPKKSYVNYKVLQEQIKEKKAAKEEEKRLAQETDIFKKKKRKGQEDRKSKKKSAPSILSNGRIGQVGKFKNGTLILSPVDIKKINSSRVAKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name C1orf131 chromosome 1 open reading frame 131 [ Homo sapiens (human) ]
Official Symbol C1orf131
Synonyms C1ORF131; chromosome 1 open reading frame 131; uncharacterized protein C1orf131; DKFZp547B1713;
Gene ID 128061
mRNA Refseq NM_152379
Protein Refseq NP_689592
UniProt ID Q8NDD1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C1orf131 Products

Required fields are marked with *

My Review for All C1orf131 Products

Required fields are marked with *

0
cart-icon
0
compare icon