Recombinant Human C1orf189 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | C1orf189-648H |
Product Overview : | C1orf189 MS Standard C13 and N15-labeled recombinant protein (NP_001010979) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | C1orf189 (Chromosome 1 Open Reading Frame 189) is a Protein Coding gene. |
Molecular Mass : | 12.1 kDa |
AA Sequence : | MSVEKMTKVEESFQKAMGLKKTVDRWRNSHTHCLWQMALGQRRNPYATLRMQDTMVQELALAKKQLLMVRQAALHQLFEKEHQQYQQELNQMGKAFYVERFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | C1orf189 chromosome 1 open reading frame 189 [ Homo sapiens (human) ] |
Official Symbol | C1orf189 |
Synonyms | C1orf189; chromosome 1 open reading frame 189; |
Gene ID | 388701 |
mRNA Refseq | NM_001010979 |
Protein Refseq | NP_001010979 |
UniProt ID | Q5VU69 |
◆ Recombinant Proteins | ||
C1orf189-648H | Recombinant Human C1orf189 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
C1orf189-8169HCL | Recombinant Human C1orf189 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C1orf189 Products
Required fields are marked with *
My Review for All C1orf189 Products
Required fields are marked with *