Recombinant Human C1orf189 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: C1orf189-648H
• Product Overview: C1orf189 MS Standard C13 and N15-labeled recombinant protein (NP_001010979) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: C1orf189 (Chromosome 1 Open Reading Frame 189) is a Protein Coding gene.
• Molecular Mass: 12.1 kDa
• AA Sequence: MSVEKMTKVEESFQKAMGLKKTVDRWRNSHTHCLWQMALGQRRNPYATLRMQDTMVQELALAKKQLLMVRQAALHQLFEKEHQQYQQELNQMGKAFYVERFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: C1orf189 chromosome 1 open reading frame 189 [ Homo sapiens (human) ]
• Official Symbol: C1orf189
• Synonyms: C1orf189; chromosome 1 open reading frame 189
• Gene ID: 388701
• mRNA Refseq: NM_001010979
• Protein Refseq: NP_001010979
• UniProt ID: Q5VU69