Recombinant Human C1orf43 protein, His&Myc-tagged
Cat.No. : | C1orf43-3242H |
Product Overview : | Recombinant Human C1orf43 protein(Q9BWL3)(32-253aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 32-253aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 32.9 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | KRQIMRFAMKSRRGPHVPVGHNAPKDLKEEIDIRLSRVQDIKYEPQLLADDDARLLQLETQGNQSCYNYLYRMKALDAIRTSEIPFHSEGRHPRSLMGKNFRSYLLDLRNTSTPFKGVRKALIDTLLDGYETARYGTGVFGQNEYLRYQEALSELATAVKARIGSSQRHHQSAAKDLTQSPEVSPTTIQVTYLPSSQKSKRAKHFLELKSFKDNYNTLESTL |
Gene Name | C1orf43 chromosome 1 open reading frame 43 [ Homo sapiens ] |
Official Symbol | C1orf43 |
Synonyms | C1ORF43; chromosome 1 open reading frame 43; uncharacterized protein C1orf43; DKFZp586G1722; NICE 3; protein NICE-3; HCV NS5A-transactivated protein 4; hepatitis C virus NS5A-transactivated protein 4; NICE-3; S863-3; HSPC012; NS5ATP4; MGC111001; |
Gene ID | 25912 |
mRNA Refseq | NM_001098616 |
Protein Refseq | NP_001092086 |
UniProt ID | Q9BWL3 |
◆ Recombinant Proteins | ||
C1orf43-10464H | Recombinant Human C1orf43, GST-tagged | +Inquiry |
C1orf43-3242H | Recombinant Human C1orf43 protein, His&Myc-tagged | +Inquiry |
RFL21652HF | Recombinant Full Length Human Uncharacterized Protein C1Orf43(C1Orf43) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C1orf43-97HCL | Recombinant Human C1orf43 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C1orf43 Products
Required fields are marked with *
My Review for All C1orf43 Products
Required fields are marked with *