Recombinant Human C1orf43 protein, His&Myc-tagged

• Cat.No.: C1orf43-3242H
• Product Overview: Recombinant Human C1orf43 protein(Q9BWL3)(32-253aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Myc
• Protein Length: 32-253aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 32.9 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: KRQIMRFAMKSRRGPHVPVGHNAPKDLKEEIDIRLSRVQDIKYEPQLLADDDARLLQLETQGNQSCYNYLYRMKALDAIRTSEIPFHSEGRHPRSLMGKNFRSYLLDLRNTSTPFKGVRKALIDTLLDGYETARYGTGVFGQNEYLRYQEALSELATAVKARIGSSQRHHQSAAKDLTQSPEVSPTTIQVTYLPSSQKSKRAKHFLELKSFKDNYNTLESTL

Gene Information

• Gene Name: C1orf43 chromosome 1 open reading frame 43 [ Homo sapiens ]
• Official Symbol: C1orf43
• Synonyms: C1ORF43; chromosome 1 open reading frame 43; uncharacterized protein C1orf43; DKFZp586G1722; NICE 3; protein NICE-3; HCV NS5A-transactivated protein 4; hepatitis C virus NS5A-transactivated protein 4; NICE-3; S863-3; HSPC012; NS5ATP4; MGC111001
• Gene ID: 25912
• mRNA Refseq: NM_001098616
• Protein Refseq: NP_001092086
• UniProt ID: Q9BWL3