Recombinant Human C1orf50 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | C1orf50-4375H |
Product Overview : | C1orf50 MS Standard C13 and N15-labeled recombinant protein (NP_077002) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | C1orf50 (Chromosome 1 Open Reading Frame 50) is a Protein Coding gene. |
Molecular Mass : | 21.9 kDa |
AA Sequence : | MEDAAAPGRTEGVLERQGAPPAAGQGGALVELTPTPGGLALVSPYHTHRAGDPLDLVALAEQVQKADEFIRANATNKLTVIAEQIQHLQEQARKVLEDAHRDANLHHVACNIVKKPGNIYYLYKRESGQQYFSIISPKEWGTSCPHDFLGAYKLQHDLSWTPYEDIEKQDAKISMMDMLLSQSVALPPCTEPNFQGLTHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | C1orf50 chromosome 1 open reading frame 50 [ Homo sapiens (human) ] |
Official Symbol | C1orf50 |
Synonyms | C1ORF50; chromosome 1 open reading frame 50; uncharacterized protein C1orf50; MGC955; |
Gene ID | 79078 |
mRNA Refseq | NM_024097 |
Protein Refseq | NP_077002 |
UniProt ID | Q9BV19 |
◆ Recombinant Proteins | ||
C1orf50-10465H | Recombinant Human C1orf50, GST-tagged | +Inquiry |
C1orf50-4375H | Recombinant Human C1orf50 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
C1orf50-8157HCL | Recombinant Human C1orf50 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C1orf50 Products
Required fields are marked with *
My Review for All C1orf50 Products
Required fields are marked with *
0
Inquiry Basket