Recombinant Human C1orf52 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: C1orf52-6508H
• Product Overview: C1orf52 MS Standard C13 and N15-labeled recombinant protein (NP_932343) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: C1orf52 (Chromosome 1 Open Reading Frame 52) is a Protein Coding gene. Diseases associated with C1orf52 include Cardiomyopathy, Familial Hypertrophic, 2.
• Molecular Mass: 20.4 kDa
• AA Sequence: MAAEEKDPLSYFAAYGSSSSGSSDEEDNIEPEETSRRTPDPAKSAGGCRNKAEKRLPGPDELFRSVTRPAFLYNPLNKQIDWERHVVKAPEEPPKEFKIWKSNYVPPPETYTTEKKPPPPELDMAIKWSNIYEDNGDDAPQNAKKARLLPEGEETLESDDEKDEHTSKKRKVEPGEPAKKKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: C1orf52 chromosome 1 open reading frame 52 [ Homo sapiens (human) ]
• Official Symbol: C1orf52
• Synonyms: C1ORF52; chromosome 1 open reading frame 52; UPF0690 protein C1orf52; FLJ44982; gm117; BCL10-associated gene protein; RP11-234D19.1
• Gene ID: 148423
• mRNA Refseq: NM_198077
• Protein Refseq: NP_932343
• UniProt ID: Q8N6N3