Recombinant Human C1QTNF3 protein, His&Myc-tagged
Cat.No. : | C1QTNF3-2341H |
Product Overview : | Recombinant Human C1QTNF3 protein(Q9BXJ4)(23-246aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect Cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His&Myc |
Protein Length : | 23-246aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 28.1 kDa |
AA Sequence : | QDEYMESPQTGGLPPDCSKCCHGDYSFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGIPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEMKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | C1QTNF3 C1q and tumor necrosis factor related protein 3 [ Homo sapiens ] |
Official Symbol | C1QTNF3 |
Synonyms | C1QTNF3; C1q and tumor necrosis factor related protein 3; complement C1q tumor necrosis factor-related protein 3; 2310005P21Rik; cartonectin; Corcs; Cors; Cors 26; CTRP3; secretory protein CORS26; collagenous repeat-containing sequence of 26-kDa; CORS; CORCS; CORS26; C1ATNF3; CORS-26; FLJ37576; |
Gene ID | 114899 |
mRNA Refseq | NM_030945 |
Protein Refseq | NP_112207 |
MIM | 612045 |
UniProt ID | Q9BXJ4 |
◆ Recombinant Proteins | ||
C1QTNF3-1852HFL | Recombinant Full Length Human C1QTNF3 Protein, C-Flag-tagged | +Inquiry |
C1QTNF3-467H | Recombinant Human C1QTNF3 Protein, His (Fc)-Avi-tagged | +Inquiry |
C1QTNF3-2761M | Recombinant Mouse C1QTNF3 Protein (23-246 aa), His-tagged | +Inquiry |
C1QTNF3-2464H | Recombinant Human C1QTNF3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
C1qtnf3-5128M | Recombinant Mouse C1qtnf3 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C1QTNF3-8137HCL | Recombinant Human C1QTNF3 293 Cell Lysate | +Inquiry |
C1QTNF3-8136HCL | Recombinant Human C1QTNF3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C1QTNF3 Products
Required fields are marked with *
My Review for All C1QTNF3 Products
Required fields are marked with *