Recombinant Human C1QTNF3 protein, His&Myc-tagged
| Cat.No. : | C1QTNF3-2341H |
| Product Overview : | Recombinant Human C1QTNF3 protein(Q9BXJ4)(23-246aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect Cell. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Insect Cells |
| Tag : | His&Myc |
| Protein Length : | 23-246aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 28.1 kDa |
| AA Sequence : | QDEYMESPQTGGLPPDCSKCCHGDYSFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGIPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEMKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | C1QTNF3 C1q and tumor necrosis factor related protein 3 [ Homo sapiens ] |
| Official Symbol | C1QTNF3 |
| Synonyms | C1QTNF3; C1q and tumor necrosis factor related protein 3; complement C1q tumor necrosis factor-related protein 3; 2310005P21Rik; cartonectin; Corcs; Cors; Cors 26; CTRP3; secretory protein CORS26; collagenous repeat-containing sequence of 26-kDa; CORS; CORCS; CORS26; C1ATNF3; CORS-26; FLJ37576; |
| Gene ID | 114899 |
| mRNA Refseq | NM_030945 |
| Protein Refseq | NP_112207 |
| MIM | 612045 |
| UniProt ID | Q9BXJ4 |
| ◆ Recombinant Proteins | ||
| C1QTNF3-2464H | Recombinant Human C1QTNF3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| C1QTNF3-2801Z | Recombinant Zebrafish C1QTNF3 | +Inquiry |
| C1QTNF3-1852HFL | Recombinant Full Length Human C1QTNF3 Protein, C-Flag-tagged | +Inquiry |
| C1QTNF3-2504M | Recombinant Mouse C1QTNF3 Protein (23-246 aa), His-Myc-tagged | +Inquiry |
| C1QTNF3-2761M | Recombinant Mouse C1QTNF3 Protein (23-246 aa), His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| C1QTNF3-8137HCL | Recombinant Human C1QTNF3 293 Cell Lysate | +Inquiry |
| C1QTNF3-8136HCL | Recombinant Human C1QTNF3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C1QTNF3 Products
Required fields are marked with *
My Review for All C1QTNF3 Products
Required fields are marked with *
