Recombinant Mouse C1QTNF3 Protein (23-246 aa), His-tagged

Cat.No. : C1QTNF3-2761M
Product Overview : Recombinant Mouse C1QTNF3 Protein (23-246 aa) is produced by Baculovirus expression system. This protein is fused with a 10xHis tag at the N-terminal. Research Area: Metabolism. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Insect Cells
Tag : His
Protein Length : 23-246 aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 26.6 kDa
AA Sequence : QDEYMESPQAGGLPPDCSKCCHGDYGFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGVPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYETKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name C1qtnf3 C1q and tumor necrosis factor related protein 3 [ Mus musculus ]
Official Symbol C1QTNF3
Synonyms C1QTNF3; cartducin; cartonectin; secretory protein CORS26; Cors; CTRP3; Corcs; CORS-26; 2310005P21Rik;
Gene ID 81799
mRNA Refseq NM_001204134
Protein Refseq NP_001191063
UniProt ID Q9ES30

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C1QTNF3 Products

Required fields are marked with *

My Review for All C1QTNF3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon