Recombinant Mouse C1QTNF3 Protein (23-246 aa), His-tagged
| Cat.No. : | C1QTNF3-2761M |
| Product Overview : | Recombinant Mouse C1QTNF3 Protein (23-246 aa) is produced by Baculovirus expression system. This protein is fused with a 10xHis tag at the N-terminal. Research Area: Metabolism. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | Insect Cells |
| Tag : | His |
| Protein Length : | 23-246 aa |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 26.6 kDa |
| AA Sequence : | QDEYMESPQAGGLPPDCSKCCHGDYGFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGVPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYETKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK |
| Purity : | > 85% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | C1qtnf3 C1q and tumor necrosis factor related protein 3 [ Mus musculus ] |
| Official Symbol | C1QTNF3 |
| Synonyms | C1QTNF3; cartducin; cartonectin; secretory protein CORS26; Cors; CTRP3; Corcs; CORS-26; 2310005P21Rik; |
| Gene ID | 81799 |
| mRNA Refseq | NM_001204134 |
| Protein Refseq | NP_001191063 |
| UniProt ID | Q9ES30 |
| ◆ Recombinant Proteins | ||
| C1QTNF3-4240H | Recombinant Human C1q And Tumor Necrosis Factor Related Protein 3, His-tagged | +Inquiry |
| C1QTNF3-2801Z | Recombinant Zebrafish C1QTNF3 | +Inquiry |
| C1QTNF3-1852HFL | Recombinant Full Length Human C1QTNF3 Protein, C-Flag-tagged | +Inquiry |
| C1QTNF3-27140TH | Recombinant Human C1QTNF3, His-tagged | +Inquiry |
| C1QTNF3-4898H | Recombinant Human C1QTNF3 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| C1QTNF3-8137HCL | Recombinant Human C1QTNF3 293 Cell Lysate | +Inquiry |
| C1QTNF3-8136HCL | Recombinant Human C1QTNF3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C1QTNF3 Products
Required fields are marked with *
My Review for All C1QTNF3 Products
Required fields are marked with *



