Recombinant Mouse C1QTNF3 Protein (23-246 aa), His-tagged

• Cat.No.: C1QTNF3-2761M
• Product Overview: Recombinant Mouse C1QTNF3 Protein (23-246 aa) is produced by Baculovirus expression system. This protein is fused with a 10xHis tag at the N-terminal. Research Area: Metabolism. Protein Description: Full Length of Mature Protein.

Specification

• Species: Mouse
• Source: Insect Cells
• Tag: His
• Protein Length: 23-246 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 26.6 kDa
• AA Sequence: QDEYMESPQAGGLPPDCSKCCHGDYGFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGVPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYETKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: C1qtnf3 C1q and tumor necrosis factor related protein 3 [ Mus musculus ]
• Official Symbol: C1QTNF3
• Synonyms: C1QTNF3; cartducin; cartonectin; secretory protein CORS26; Cors; CTRP3; Corcs; CORS-26; 2310005P21Rik
• Gene ID: 81799
• mRNA Refseq: NM_001204134
• Protein Refseq: NP_001191063
• UniProt ID: Q9ES30