Recombinant Human C20orf112 protein, GST-tagged

Cat.No. : C20orf112-301428H
Product Overview : Recombinant Human C20orf112 (40-166 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Ser40-Asp166
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : SSESGSGNGSSTLNPSTSSSTQGDPAFPEMNGNGAVAPMDFTTAAEDQPINLCDKLPPATALGTASYPSDGCGADGLRSRVKYGVKTTPESPPYSSGSYDSIKTEVSGCPEDLTVGRAPTADDDDDD
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name C20orf112 chromosome 20 open reading frame 112 [ Homo sapiens ]
Official Symbol C20orf112
Synonyms C20ORF112; chromosome 20 open reading frame 112; C20orf113, chromosome 20 open reading frame 113; uncharacterized protein C20orf112; dJ1184F4.2; dJ1184F4.4; DKFZP566G1424; hypothetical protein LOC140688; C20orf113; DKFZp566G1424;
Gene ID 140688
mRNA Refseq NM_001256798
Protein Refseq NP_001243727
UniProt ID Q96MY1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C20orf112 Products

Required fields are marked with *

My Review for All C20orf112 Products

Required fields are marked with *

0
cart-icon