Recombinant Human C20orf112 protein, GST-tagged

• Cat.No.: C20orf112-301428H
• Product Overview: Recombinant Human C20orf112 (40-166 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Ser40-Asp166
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: SSESGSGNGSSTLNPSTSSSTQGDPAFPEMNGNGAVAPMDFTTAAEDQPINLCDKLPPATALGTASYPSDGCGADGLRSRVKYGVKTTPESPPYSSGSYDSIKTEVSGCPEDLTVGRAPTADDDDDD
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: C20orf112 chromosome 20 open reading frame 112 [ Homo sapiens ]
• Official Symbol: C20orf112
• Synonyms: C20ORF112; chromosome 20 open reading frame 112; C20orf113, chromosome 20 open reading frame 113; uncharacterized protein C20orf112; dJ1184F4.2; dJ1184F4.4; DKFZP566G1424; hypothetical protein LOC140688; C20orf113; DKFZp566G1424
• Gene ID: 140688
• mRNA Refseq: NM_001256798
• Protein Refseq: NP_001243727
• UniProt ID: Q96MY1