Recombinant Human C20orf202 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | C20orf202-6022H |
| Product Overview : | C20orf202 MS Standard C13 and N15-labeled recombinant protein (NP_001009612) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | C20orf202 (Chromosome 20 Open Reading Frame 202) is a Protein Coding gene. An important paralog of this gene is FAM167B. |
| Molecular Mass : | 13.4 kDa |
| AA Sequence : | MYKSKIPRAQNQVSVKVTPKNTEMKIAEEPSPSLGQTLEWLRKELSEMQIQDQSLLLTLRHLHSVLEELRADSAHWEDARSSGGTSPIRARAGSEGRGCQPVCSRGLAQLLRGEDSRRSSLPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | C20orf202 chromosome 20 open reading frame 202 [ Homo sapiens (human) ] |
| Official Symbol | C20orf202 |
| Synonyms | C20orf202; chromosome 20 open reading frame 202; uncharacterized protein C20orf202 |
| Gene ID | 400831 |
| mRNA Refseq | NM_001009612 |
| Protein Refseq | NP_001009612 |
| UniProt ID | A1L168 |
| ◆ Recombinant Proteins | ||
| C20orf202-6022H | Recombinant Human C20orf202 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C20orf202 Products
Required fields are marked with *
My Review for All C20orf202 Products
Required fields are marked with *
