Recombinant Human C2orf3 protein, GST-tagged
Cat.No. : | C2orf3-301170H |
Product Overview : | Recombinant Human C2orf3 (1-133 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Lys133 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MAHRPKRTFRQRAADSSDSDGAEESPAEPGAARELPVPGSAEEEPPSGGGRAQVAGLPHRVRGPRGRGRVWASSRRATKAAPRADEGSESRTLDVSTDEEDKIHHSSESKDDQGLSSDSSSSLGEKELSSTVK |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | GCFC2 GC-rich sequence DNA-binding factor 2 [ Homo sapiens (human) |
Official Symbol | C2orf3 |
Synonyms | GCFC2; GCF; TCF9; DNABF |
Gene ID | 6936 |
mRNA Refseq | NM_001201334 |
Protein Refseq | NP_001188263 |
MIM | 189901 |
UniProt ID | P16383 |
◆ Recombinant Proteins | ||
C2orf3-301170H | Recombinant Human C2orf3 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C2orf3 Products
Required fields are marked with *
My Review for All C2orf3 Products
Required fields are marked with *