Recombinant Human C2orf69 protein, His&Myc-tagged

Cat.No. : C2orf69-165H
Product Overview : Recombinant Human C2orf69 protein(Q8N8R5)(25-385aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect Cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : His&Myc
Protein Length : 25-385aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 44.7kDa
AA Sequence : SSCSQARTMNPGGSGGARCSLSAEVRRRQCLQLSTVPGADPQRSNELLLLAAAGEGLERQDLPGDPAKEEPQPPPQHHVLYFPGDVQNYHEIMTRHPENYQWENWSLENVATILAHRFPNSYIWVIKCSRMHLHKFSCYDNFVKSNMFGAPEHNTDFGAFKHLYMLLVNAFNLSQNSLSKKSLNVWNKDSIASNCRSSPSHTTNGCQGEKVRTCEKSDESAMSFYPPSLNDASFTLIGFSKGCVVLNQLLFELKEAKKDKNIDAFIKSIRTMYWLDGGHSGGSNTWVTYPEVLKEFAQTGIIVHTHVTPYQVRDPMRSWIGKEHKKFVQILGDLGMQVTSQIHFTKEAPSIENHFRVHEVF
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name C2orf69 chromosome 2 open reading frame 69 [ Homo sapiens ]
Official Symbol C2orf69
Synonyms C2ORF69; chromosome 2 open reading frame 69; UPF0565 protein C2orf69; FLJ38973; hypothetical protein FLJ38973;
Gene ID 205327
mRNA Refseq NM_153689
Protein Refseq NP_710156
UniProt ID Q8N8R5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C2orf69 Products

Required fields are marked with *

My Review for All C2orf69 Products

Required fields are marked with *

0
cart-icon