Recombinant Human C2orf69 protein, His&Myc-tagged
Cat.No. : | C2orf69-165H |
Product Overview : | Recombinant Human C2orf69 protein(Q8N8R5)(25-385aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect Cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His&Myc |
Protein Length : | 25-385aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 44.7kDa |
AA Sequence : | SSCSQARTMNPGGSGGARCSLSAEVRRRQCLQLSTVPGADPQRSNELLLLAAAGEGLERQDLPGDPAKEEPQPPPQHHVLYFPGDVQNYHEIMTRHPENYQWENWSLENVATILAHRFPNSYIWVIKCSRMHLHKFSCYDNFVKSNMFGAPEHNTDFGAFKHLYMLLVNAFNLSQNSLSKKSLNVWNKDSIASNCRSSPSHTTNGCQGEKVRTCEKSDESAMSFYPPSLNDASFTLIGFSKGCVVLNQLLFELKEAKKDKNIDAFIKSIRTMYWLDGGHSGGSNTWVTYPEVLKEFAQTGIIVHTHVTPYQVRDPMRSWIGKEHKKFVQILGDLGMQVTSQIHFTKEAPSIENHFRVHEVF |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | C2orf69 chromosome 2 open reading frame 69 [ Homo sapiens ] |
Official Symbol | C2orf69 |
Synonyms | C2ORF69; chromosome 2 open reading frame 69; UPF0565 protein C2orf69; FLJ38973; hypothetical protein FLJ38973; |
Gene ID | 205327 |
mRNA Refseq | NM_153689 |
Protein Refseq | NP_710156 |
UniProt ID | Q8N8R5 |
◆ Recombinant Proteins | ||
C2orf69-87H | Recombinant Human C2orf69 protein, His-tagged | +Inquiry |
C2orf69-166H | Recombinant Human C2orf69 protein, hFc-tagged | +Inquiry |
C2orf69-165H | Recombinant Human C2orf69 protein, His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C2orf69-8065HCL | Recombinant Human C2orf69 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C2orf69 Products
Required fields are marked with *
My Review for All C2orf69 Products
Required fields are marked with *