Recombinant Human C2orf76 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : C2orf76-2986H
Product Overview : C2orf76 MS Standard C13 and N15-labeled recombinant protein (NP_001017927) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : C2orf76 (Chromosome 2 Open Reading Frame 76) is a Protein Coding gene.
Molecular Mass : 14.6 kDa
AA Sequence : MAPGEVTITVRLIRSFEHRNFKPVVYHGVNLDQTVKEFIVFLKQDVPLRTNLPPPFRNYKYDALKIIHQAHKSKTNELVLSLEDDERLLLKEDSTLKAAGIASETEIAFFCEEDYRNYKANPISSWTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name C2orf76 chromosome 2 open reading frame 76 [ Homo sapiens (human) ]
Official Symbol C2orf76
Synonyms C2orf76; chromosome 2 open reading frame 76; AIM29; UPF0538 protein C2orf76
Gene ID 130355
mRNA Refseq NM_001017927
Protein Refseq NP_001017927
UniProt ID Q3KRA6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C2orf76 Products

Required fields are marked with *

My Review for All C2orf76 Products

Required fields are marked with *

0
cart-icon
0
compare icon