Recombinant Human C2orf76 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: C2orf76-2986H
• Product Overview: C2orf76 MS Standard C13 and N15-labeled recombinant protein (NP_001017927) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: C2orf76 (Chromosome 2 Open Reading Frame 76) is a Protein Coding gene.
• Molecular Mass: 14.6 kDa
• AA Sequence: MAPGEVTITVRLIRSFEHRNFKPVVYHGVNLDQTVKEFIVFLKQDVPLRTNLPPPFRNYKYDALKIIHQAHKSKTNELVLSLEDDERLLLKEDSTLKAAGIASETEIAFFCEEDYRNYKANPISSWTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: C2orf76 chromosome 2 open reading frame 76 [ Homo sapiens (human) ]
• Official Symbol: C2orf76
• Synonyms: C2orf76; chromosome 2 open reading frame 76; AIM29; UPF0538 protein C2orf76
• Gene ID: 130355
• mRNA Refseq: NM_001017927
• Protein Refseq: NP_001017927
• UniProt ID: Q3KRA6