Recombinant Human C3 protein(961-1040 aa), C-His-tagged

Cat.No. : C3-2505H
Product Overview : Recombinant Human C3 protein(P01024)(961-1040 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 961-1040 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : DIPPADLSDQVPDTESETRILLQGTPVAQMTEDAVDAERLKHLIVTPSGCGEQNMIGMTPTVIAVHYLDETEQWEKFGLE
Gene Name C3 complement component 3 [ Homo sapiens ]
Official Symbol C3
Synonyms C3; complement component 3; complement C3; CPAMD1; complement component C3; acylation-stimulating protein cleavage product; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1; ASP; AHUS5; ARMD9;
Gene ID 718
mRNA Refseq NM_000064
Protein Refseq NP_000055
MIM 120700
UniProt ID P01024

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C3 Products

Required fields are marked with *

My Review for All C3 Products

Required fields are marked with *

0
cart-icon
0
compare icon