Recombinant Human C3 protein(961-1040 aa), C-His-tagged
Cat.No. : | C3-2505H |
Product Overview : | Recombinant Human C3 protein(P01024)(961-1040 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 961-1040 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | DIPPADLSDQVPDTESETRILLQGTPVAQMTEDAVDAERLKHLIVTPSGCGEQNMIGMTPTVIAVHYLDETEQWEKFGLE |
Gene Name | C3 complement component 3 [ Homo sapiens ] |
Official Symbol | C3 |
Synonyms | C3; complement component 3; complement C3; CPAMD1; complement component C3; acylation-stimulating protein cleavage product; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1; ASP; AHUS5; ARMD9; |
Gene ID | 718 |
mRNA Refseq | NM_000064 |
Protein Refseq | NP_000055 |
MIM | 120700 |
UniProt ID | P01024 |
◆ Recombinant Proteins | ||
C3-7842H | Recombinant Human C3 protein, His-tagged | +Inquiry |
C3-7632M | Recombinant Mouse C3 protein, His-tagged | +Inquiry |
C3-1944M | Recombinant Mouse C3 protein, His-tagged | +Inquiry |
C3-5695R | Recombinant Rat C3 protein, His-tagged | +Inquiry |
C3-732M | Recombinant Mouse C3 Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
C3-012H | Native Human Complement C3c | +Inquiry |
C3-365H | Active Native Human C3 Protein | +Inquiry |
C3-02M | Native Monkey C3 Protein | +Inquiry |
C3-8092H | Native Human Plasma COMPLEMENT C (C3) | +Inquiry |
C3-01R | Native Rabbit C3 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C3 Products
Required fields are marked with *
My Review for All C3 Products
Required fields are marked with *