Recombinant Human C3 protein(961-1040 aa), C-His-tagged
| Cat.No. : | C3-2505H |
| Product Overview : | Recombinant Human C3 protein(P01024)(961-1040 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 961-1040 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | DIPPADLSDQVPDTESETRILLQGTPVAQMTEDAVDAERLKHLIVTPSGCGEQNMIGMTPTVIAVHYLDETEQWEKFGLE |
| Gene Name | C3 complement component 3 [ Homo sapiens ] |
| Official Symbol | C3 |
| Synonyms | C3; complement component 3; complement C3; CPAMD1; complement component C3; acylation-stimulating protein cleavage product; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1; ASP; AHUS5; ARMD9; |
| Gene ID | 718 |
| mRNA Refseq | NM_000064 |
| Protein Refseq | NP_000055 |
| MIM | 120700 |
| UniProt ID | P01024 |
| ◆ Recombinant Proteins | ||
| C3-558H | Recombinant Human C3 Protein, His/GST-tagged | +Inquiry |
| C3-4325S | Recombinant Swine C3 Protein | +Inquiry |
| C3-559M | Recombinant Mouse C3 Protein, His/GST-tagged | +Inquiry |
| C3-4246M | Recombinant Mouse C3 protein, His-SUMO-tagged | +Inquiry |
| C3-732M | Recombinant Mouse C3 Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Native Proteins | ||
| C3-08R | Native Rat C3 Protein | +Inquiry |
| C3-05M | Native Mouse C3 Protein | +Inquiry |
| C3-02M | Native Monkey C3 Protein | +Inquiry |
| C3-01R | Native Rabbit C3 Protein | +Inquiry |
| C3-012H | Native Human Complement C3c | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| C3-078HKCL | Human C3 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C3 Products
Required fields are marked with *
My Review for All C3 Products
Required fields are marked with *
