"C3" Related Products

Recombinant Human C3 Protein, His-tagged

Cat.No. : C3-1149H
Product Overview : Recombinant Human C3 Protein (26-225aa) was expressed in E. coli with N-terminal His-tag.
Source : E. coli
Species : Human
Tag : His
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 26.4 kDa
AA Sequence : YSIITPNILRLESEETMVLEAHDAQGDVPVTVTVHDFPGKKLVLSSEKTVLTPATNHMGNVTFTIPANREFKSEKGRNKFVTVQATFGTQVVEKVVLVSLQSGYLFIQTDKTIYTPGSTVLYRIFTVNHKLLPVGRTVMVNIENPEGIPVKQDSLSSQNQLGVLPLSWDIPELVNMGQWKIRAYYENSPQQVFSTEFEVK
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name : C3 complement C3 [ Homo sapiens (human) ]
Official Symbol : C3
Synonyms : ASP; C3a; C3b; AHUS5; ARMD9; CPAMD1; HEL-S-62p; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1; C3a anaphylatoxin; acylation-stimulating protein cleavage product; complement component 3; complement component C3a; complement component C3b; epididymis secretory sperm binding protein Li 62p; prepro-C3; complement C3
Gene ID : 718
mRNA Refseq : NM_000064.3
Protein Refseq : NP_000055.2
UniProt ID : P01024

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.