Recombinant Human C3 Protein, His-tagged

Cat.No. : C3-1149H
Product Overview : Recombinant Human C3 Protein (26-225aa) was expressed in E. coli with N-terminal His-tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 26-225 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 26.4 kDa
AA Sequence : YSIITPNILRLESEETMVLEAHDAQGDVPVTVTVHDFPGKKLVLSSEKTVLTPATNHMGNVTFTIPANREFKSEKGRNKFVTVQATFGTQVVEKVVLVSLQSGYLFIQTDKTIYTPGSTVLYRIFTVNHKLLPVGRTVMVNIENPEGIPVKQDSLSSQNQLGVLPLSWDIPELVNMGQWKIRAYYENSPQQVFSTEFEVK
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name C3 complement C3 [ Homo sapiens (human) ]
Official Symbol C3
Synonyms ASP; C3a; C3b; AHUS5; ARMD9; CPAMD1; HEL-S-62p; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1; C3a anaphylatoxin; acylation-stimulating protein cleavage product; complement component 3; complement component C3a; complement component C3b; epididymis secretory sperm binding protein Li 62p; prepro-C3; complement C3
Gene ID 718
mRNA Refseq NM_000064.3
Protein Refseq NP_000055.2
UniProt ID P01024

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C3 Products

Required fields are marked with *

My Review for All C3 Products

Required fields are marked with *

0
cart-icon