Recombinant Human C3 Protein, His-tagged

• Cat.No.: C3-1149H
• Product Overview: Recombinant Human C3 Protein (26-225aa) was expressed in E. coli with N-terminal His-tag.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 26-225 a.a.
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 26.4 kDa
• AA Sequence: YSIITPNILRLESEETMVLEAHDAQGDVPVTVTVHDFPGKKLVLSSEKTVLTPATNHMGNVTFTIPANREFKSEKGRNKFVTVQATFGTQVVEKVVLVSLQSGYLFIQTDKTIYTPGSTVLYRIFTVNHKLLPVGRTVMVNIENPEGIPVKQDSLSSQNQLGVLPLSWDIPELVNMGQWKIRAYYENSPQQVFSTEFEVK
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information

• Gene Name: C3 complement C3 [ Homo sapiens (human) ]
• Official Symbol: C3
• Synonyms: ASP; C3a; C3b; AHUS5; ARMD9; CPAMD1; HEL-S-62p; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1; C3a anaphylatoxin; acylation-stimulating protein cleavage product; complement component 3; complement component C3a; complement component C3b; epididymis secretory sperm binding protein Li 62p; prepro-C3; complement C3
• Gene ID: 718
• mRNA Refseq: NM_000064.3
• Protein Refseq: NP_000055.2
• UniProt ID: P01024