Recombinant Human C3 Protein, His-tagged
Cat.No. : | C3-1149H |
Product Overview : | Recombinant Human C3 Protein (26-225aa) was expressed in E. coli with N-terminal His-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 26-225 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 26.4 kDa |
AA Sequence : | YSIITPNILRLESEETMVLEAHDAQGDVPVTVTVHDFPGKKLVLSSEKTVLTPATNHMGNVTFTIPANREFKSEKGRNKFVTVQATFGTQVVEKVVLVSLQSGYLFIQTDKTIYTPGSTVLYRIFTVNHKLLPVGRTVMVNIENPEGIPVKQDSLSSQNQLGVLPLSWDIPELVNMGQWKIRAYYENSPQQVFSTEFEVK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | C3 complement C3 [ Homo sapiens (human) ] |
Official Symbol | C3 |
Synonyms | ASP; C3a; C3b; AHUS5; ARMD9; CPAMD1; HEL-S-62p; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1; C3a anaphylatoxin; acylation-stimulating protein cleavage product; complement component 3; complement component C3a; complement component C3b; epididymis secretory sperm binding protein Li 62p; prepro-C3; complement C3 |
Gene ID | 718 |
mRNA Refseq | NM_000064.3 |
Protein Refseq | NP_000055.2 |
UniProt ID | P01024 |
◆ Recombinant Proteins | ||
C3-114C | Active Recombinant Cynomolgus C3 protein, His-tagged | +Inquiry |
C3-1944M | Recombinant Mouse C3 protein, His-tagged | +Inquiry |
C3-603H | Active Recombinant Human C3 | +Inquiry |
C3-471H | Recombinant Human C3 Protein, His (Fc)-Avi-tagged | +Inquiry |
C3-4325S | Recombinant Swine C3 Protein | +Inquiry |
◆ Native Proteins | ||
C3-194H | Native Human Complement C3c | +Inquiry |
C3-8092H | Native Human Plasma COMPLEMENT C (C3) | +Inquiry |
C3-365H | Active Native Human C3 Protein | +Inquiry |
C3-02M | Native Monkey C3 Protein | +Inquiry |
C3-08R | Native Rat C3 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C3 Products
Required fields are marked with *
My Review for All C3 Products
Required fields are marked with *
0
Inquiry Basket