Recombinant Human C4B protein, His-SUMO-tagged
Cat.No. : | C4B-3818H |
Product Overview : | Recombinant Human C4B protein(P0C0L5)(1454-1744aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1454-1744aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 49.1 kDa |
AA Sequence : | EAPKVVEEQESRVHYTVCIWRNGKVGLSGMAIADVTLLSGFHALRADLEKLTSLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFEAVQEVPVGLVQPASATLYDYYNPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYYPRVEYGFQVKVLREDSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQGCQV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | C4B complement component 4B, telomeric [ Homo sapiens ] |
Official Symbol | C4B |
Synonyms | C4B; complement component 4B, telomeric; C4A; C4F; CO4; C4B1; C4B2; C4B3; C4B5; C4A91; C4B12; |
Gene ID | 432395 |
◆ Recombinant Proteins | ||
C4b-0053M | Recombinant Mouse C4b Protein, GST-Tagged | +Inquiry |
C4B-5582H | Recombinant Human C4B protein, His-tagged | +Inquiry |
C4b-2921M | Recombinant Mouse C4b protein(1448-1738aa), His-tagged | +Inquiry |
C4b-4533M | Recombinant Mouse C4b protein | +Inquiry |
C4B-26130TH | Recombinant Human C4B | +Inquiry |
◆ Native Proteins | ||
C4B-99H | Native Human C4b Binding Protein | +Inquiry |
C4B-10H | Native Human C4B Protein | +Inquiry |
C4B-1846H | Native Human C4B Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C4B Products
Required fields are marked with *
My Review for All C4B Products
Required fields are marked with *
0
Inquiry Basket