Recombinant Human C4B protein, His-tagged
Cat.No. : | C4B-08H |
Product Overview : | Recombinant Human C4B protein, fused to His-tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | This gene encodes the basic form of complement factor 4, and together with the C4A gene, is part of the classical activation pathway. The protein is expressed as a single chain precursor which is proteolytically cleaved into a trimer of alpha, beta, and gamma chains prior to secretion. The trimer provides a surface for interaction between the antigen-antibody complex and other complement components. The alpha chain may be cleaved to release C4 anaphylatoxin, a mediator of local inflammation. Deficiency of this protein is associated with systemic lupus erythematosus. This gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6. Varying haplotypes of this gene cluster exist, such that individuals may have 1, 2, or 3 copies of this gene. In addition, this gene exists as a long form and a short form due to the presence or absence of a 6.4 kb endogenous HERV-K retrovirus in intron 9. |
Form : | 50mM Tris-HCl, 300mM NaCl, 10% glycerol, 2mM DTT pH8.0. |
Molecular Mass : | 36.3 kDa |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFEAPKVVEEQESRVHYTVCIWRNGKVGLSGMAIADVTLLSGFHALRADLEKLTSLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFEAVQEVPVGLVQPASATLYDYYNPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYYPRVEYGFQVKVLREDSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQGCQV |
Purity : | >90% |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.651 mg/mL |
Gene Name | C4B complement C4B (Chido blood group) [ Homo sapiens (human) ] |
Official Symbol | C4B |
Synonyms | CH; C4F; CO4; C4B1; C4B2; C4B3; C4B5; C4BD; C4B12; C4B_2; CPAMD3 |
Gene ID | 721 |
mRNA Refseq | NM_001002029 |
Protein Refseq | NP_001002029 |
MIM | 120820 |
UniProt ID | P0C0L5 |
◆ Recombinant Proteins | ||
C4b-6785M | Recombinant Mouse C4b protein, His-tagged | +Inquiry |
C4B-254H | Recombinant Human C4B protein, His/T7-tagged | +Inquiry |
C4b-4333M | Recombinant Mouse C4b protein(1448-1738aa), His&Myc-tagged | +Inquiry |
C4B-341H | Recombinant Human C4B Protein, His-tagged | +Inquiry |
C4b-2921M | Recombinant Mouse C4b protein(1448-1738aa), His-tagged | +Inquiry |
◆ Native Proteins | ||
C4B-1846H | Native Human C4B Protein | +Inquiry |
C4B-10H | Native Human C4B Protein | +Inquiry |
C4B-99H | Native Human C4b Binding Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C4B Products
Required fields are marked with *
My Review for All C4B Products
Required fields are marked with *
0
Inquiry Basket