Recombinant Human C4orf26 Protein, GST-Tagged
Cat.No. : | C4orf26-0061H |
Product Overview : | Human C4orf26 full-length ORF (BAD18758.1, 1 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Dental enamel forms the outer cap of teeth and is the hardest substance found in vertebrates. This gene is thought to encode an extracellular matrix acidic phosphoprotein that has a function in enamel mineralization during amelogenesis. Mutations in this gene are associated with recessive hypomineralized amelogenesis imperfecta. [provided by RefSeq, Oct 2012] |
Molecular Mass : | 42 kDa |
AA Sequence : | MARRHCFSYWLLVCWLVVTVAEGQEEVFTLPGDSQNNADATDCQIFTLTPPPAPRSPVTRAQPITKTPRCPFHFFPRRPRIHFRFPNRPFVPSRCNHRFPFQPFYWPHRYLTYRYFPRRRLQRGSSSEES |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | C4orf26 chromosome 4 open reading frame 26 [ Homo sapiens (human) ] |
Official Symbol | C4orf26 |
Synonyms | C4orf26; chromosome 4 open reading frame 26; AI2A4; uncharacterized protein C4orf26; amelogenesis imperfecta type IIA4; Chromosome 4 Open Reading Frame 26; Amelogenesis Imperfecta Type IIA4; Uncharacterized Protein C4orf26; AI2A4 |
Gene ID | 152816 |
mRNA Refseq | NM_001206981 |
Protein Refseq | NP_001193910 |
MIM | 614829 |
UniProt ID | Q17RF5 |
◆ Recombinant Proteins | ||
C4orf26-2639HF | Recombinant Full Length Human C4orf26 Protein, GST-tagged | +Inquiry |
C4orf26-0061H | Recombinant Human C4orf26 Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C4orf26-117HCL | Recombinant Human C4orf26 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C4orf26 Products
Required fields are marked with *
My Review for All C4orf26 Products
Required fields are marked with *