Recombinant Human C4orf26 Protein, GST-Tagged

Cat.No. : C4orf26-0061H
Product Overview : Human C4orf26 full-length ORF (BAD18758.1, 1 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Dental enamel forms the outer cap of teeth and is the hardest substance found in vertebrates. This gene is thought to encode an extracellular matrix acidic phosphoprotein that has a function in enamel mineralization during amelogenesis. Mutations in this gene are associated with recessive hypomineralized amelogenesis imperfecta. [provided by RefSeq, Oct 2012]
Molecular Mass : 42 kDa
AA Sequence : MARRHCFSYWLLVCWLVVTVAEGQEEVFTLPGDSQNNADATDCQIFTLTPPPAPRSPVTRAQPITKTPRCPFHFFPRRPRIHFRFPNRPFVPSRCNHRFPFQPFYWPHRYLTYRYFPRRRLQRGSSSEES
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C4orf26 chromosome 4 open reading frame 26 [ Homo sapiens (human) ]
Official Symbol C4orf26
Synonyms C4orf26; chromosome 4 open reading frame 26; AI2A4; uncharacterized protein C4orf26; amelogenesis imperfecta type IIA4; Chromosome 4 Open Reading Frame 26; Amelogenesis Imperfecta Type IIA4; Uncharacterized Protein C4orf26; AI2A4
Gene ID 152816
mRNA Refseq NM_001206981
Protein Refseq NP_001193910
MIM 614829
UniProt ID Q17RF5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C4orf26 Products

Required fields are marked with *

My Review for All C4orf26 Products

Required fields are marked with *

0
cart-icon