Recombinant Human C4orf46 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | C4orf46-2083H |
Product Overview : | C4orf46 MS Standard C13 and N15-labeled recombinant protein (NP_001008394) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a small, conserved protein of unknown function that is expressed in a variety of tissues. There are pseudogenes for this gene on chromosomes 6, 8, 16, and X. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 11.9 kDa |
AA Sequence : | MADPEELQVSSPPPPPPSSPSSSDASAASSPGGPVSLGWPVPSRSSGPTVDQLEEVELQIGDAAFSLTKLLEATSAVSAQVEELAFKCTENARFLKTWRDLLKEGYDSLKPDDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | C4orf46 chromosome 4 open reading frame 46 [ Homo sapiens (human) ] |
Official Symbol | C4orf46 |
Synonyms | C4ORF46; chromosome 4 open reading frame 46; uncharacterized protein C4orf46; LOC201725; |
Gene ID | 201725 |
mRNA Refseq | NM_001008393 |
Protein Refseq | NP_001008394 |
MIM | 616210 |
UniProt ID | Q504U0 |
◆ Recombinant Proteins | ||
C4orf46-2083H | Recombinant Human C4orf46 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
C4orf46-8022HCL | Recombinant Human C4orf46 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C4orf46 Products
Required fields are marked with *
My Review for All C4orf46 Products
Required fields are marked with *