Recombinant Human C5AR1 protein, GST-tagged

Cat.No. : C5AR1-301544H
Product Overview : Recombinant Human C5AR1 (1-70 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Met1-Ile70
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : MNSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPDILALVIFAVVFLVGVLGNALVVWVTAFEAKRTI
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name C5AR1 complement component 5a receptor 1 [ Homo sapiens ]
Official Symbol C5AR1
Synonyms C5AR1; complement component 5a receptor 1; C5R1, complement component 5 receptor 1 (C5a ligand); C5a anaphylatoxin chemotactic receptor; C5A; C5AR; CD88; C5a-R; C5a ligand; C5a anaphylatoxin receptor; complement component 5 receptor 1; C5R1;
Gene ID 728
mRNA Refseq NM_001736
Protein Refseq NP_001727
MIM 113995
UniProt ID P21730

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C5AR1 Products

Required fields are marked with *

My Review for All C5AR1 Products

Required fields are marked with *

0
cart-icon
0
compare icon