Recombinant Human C5AR1 protein, GST-tagged
| Cat.No. : | C5AR1-301544H |
| Product Overview : | Recombinant Human C5AR1 (1-70 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Met1-Ile70 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | MNSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPDILALVIFAVVFLVGVLGNALVVWVTAFEAKRTI |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | C5AR1 complement component 5a receptor 1 [ Homo sapiens ] |
| Official Symbol | C5AR1 |
| Synonyms | C5AR1; complement component 5a receptor 1; C5R1, complement component 5 receptor 1 (C5a ligand); C5a anaphylatoxin chemotactic receptor; C5A; C5AR; CD88; C5a-R; C5a ligand; C5a anaphylatoxin receptor; complement component 5 receptor 1; C5R1; |
| Gene ID | 728 |
| mRNA Refseq | NM_001736 |
| Protein Refseq | NP_001727 |
| MIM | 113995 |
| UniProt ID | P21730 |
| ◆ Cell & Tissue Lysates | ||
| C5AR1-8019HCL | Recombinant Human C5AR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C5AR1 Products
Required fields are marked with *
My Review for All C5AR1 Products
Required fields are marked with *



