Recombinant Human C5orf64 Protein, GST-tagged

Cat.No. : C5orf64-4324H
Product Overview : Human FLJ37543 full-length ORF (BAC04439.1, 1 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : C5orf64 (Chromosome 5 Open Reading Frame 64) is a Protein Coding gene.
Molecular Mass : 40.7 kDa
AA Sequence : MLAPLFLCCLRNLFRKLISFQPPQLGRTNMHYSKLPRTAIETEFKQNVGPPPKDLTAEVYFPSIKSRSHLPAVFYNQYFKHPKCVGEYGPKNGAERQIEERKVLPTTMMFSMLADCVLKSTPIPILGVAM
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C5orf64 chromosome 5 open reading frame 64 [ Homo sapiens (human) ]
Official Symbol C5orf64
Synonyms C5orf64; chromosome 5 open reading frame 64; uncharacterized protein C5orf64
Gene ID 285668
mRNA Refseq NM_173667
Protein Refseq NP_775938
UniProt ID Q2M2E5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C5orf64 Products

Required fields are marked with *

My Review for All C5orf64 Products

Required fields are marked with *

0
cart-icon