Recombinant Human C7orf26 Protein, GST-Tagged
| Cat.No. : | C7orf26-0138H | 
| Product Overview : | Human C7orf26 full-length ORF (AAH01076.1, 1 a.a. - 352 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Description : | C7orf26 (Chromosome 7 Open Reading Frame 26) is a Protein Coding gene. | 
| Molecular Mass : | 65.4 kDa | 
| AA Sequence : | MSDIRHSLLRRDALSAAKEVLYHLDIYFSSQLQSAPLPIVDKGPVELLEEFVFQVPKERSAQPKEQTKDSVRQIIFSSLFSPQGNKADDSRMSLLGKLVSMAVAVCRIPVLECAASWLQRTPVVYCVRLAKALVDDYCCLVPGSIQTLKQIFSASPRFCCQFITSVTALYDLSSDDLIPPMDLLEMIVTWIFEDPSVLQVLMTLQLHLTEKNLYGRLGLILFDHMVPLVEEINRLADELNPLNASQEIELSLDRLAQALQVAMASGALLCTRDDLRTLCSRLPHNNLLQLVISGPVQQSPHAALPPGFYPHIHTPPLGYGAVPAHPAAHPALPTHPGHTFISGVTFPFRPIR | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | C7orf26 chromosome 7 open reading frame 26 [ Homo sapiens (human) ] | 
| Official Symbol | C7orf26 | 
| Synonyms | C7orf26; chromosome 7 open reading frame 26; uncharacterized protein C7orf26; Chromosome 7 Open Reading Frame 26 | 
| Gene ID | 79034 | 
| mRNA Refseq | NM_001303039 | 
| Protein Refseq | NP_001289968 | 
| UniProt ID | Q96N11 | 
| ◆ Recombinant Proteins | ||
| C7orf26-0138H | Recombinant Human C7orf26 Protein, GST-Tagged | +Inquiry | 
| C7orf26-1714H | Recombinant Human C7orf26 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| C7orf26-2620HF | Recombinant Full Length Human C7orf26 Protein, GST-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| C7orf26-7971HCL | Recombinant Human C7orf26 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C7orf26 Products
Required fields are marked with *
My Review for All C7orf26 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            