Recombinant Human C7orf26 Protein, GST-Tagged
Cat.No. : | C7orf26-0138H |
Product Overview : | Human C7orf26 full-length ORF (AAH01076.1, 1 a.a. - 352 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | C7orf26 (Chromosome 7 Open Reading Frame 26) is a Protein Coding gene. |
Molecular Mass : | 65.4 kDa |
AA Sequence : | MSDIRHSLLRRDALSAAKEVLYHLDIYFSSQLQSAPLPIVDKGPVELLEEFVFQVPKERSAQPKEQTKDSVRQIIFSSLFSPQGNKADDSRMSLLGKLVSMAVAVCRIPVLECAASWLQRTPVVYCVRLAKALVDDYCCLVPGSIQTLKQIFSASPRFCCQFITSVTALYDLSSDDLIPPMDLLEMIVTWIFEDPSVLQVLMTLQLHLTEKNLYGRLGLILFDHMVPLVEEINRLADELNPLNASQEIELSLDRLAQALQVAMASGALLCTRDDLRTLCSRLPHNNLLQLVISGPVQQSPHAALPPGFYPHIHTPPLGYGAVPAHPAAHPALPTHPGHTFISGVTFPFRPIR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | C7orf26 chromosome 7 open reading frame 26 [ Homo sapiens (human) ] |
Official Symbol | C7orf26 |
Synonyms | C7orf26; chromosome 7 open reading frame 26; uncharacterized protein C7orf26; Chromosome 7 Open Reading Frame 26 |
Gene ID | 79034 |
mRNA Refseq | NM_001303039 |
Protein Refseq | NP_001289968 |
UniProt ID | Q96N11 |
◆ Recombinant Proteins | ||
C7orf26-1714H | Recombinant Human C7orf26 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
C7orf26-0138H | Recombinant Human C7orf26 Protein, GST-Tagged | +Inquiry |
C7orf26-2620HF | Recombinant Full Length Human C7orf26 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C7orf26-7971HCL | Recombinant Human C7orf26 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C7orf26 Products
Required fields are marked with *
My Review for All C7orf26 Products
Required fields are marked with *
0
Inquiry Basket