Recombinant Human C8B protein, His&Myc-tagged
Cat.No. : | C8B-617H |
Product Overview : | Recombinant Human C8B protein(P07358)(55-591aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 55-591aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 68.5 kDa |
AA Sequence : | SVDVTLMPIDCELSSWSSWTTCDPCQKKRYRYAYLLQPSQFHGEPCNFSDKEVEDCVTNRPCRSQVRCEGFVCAQTGRCVNRRLLCNGDNDCGDQSDEANCRRIYKKCQHEMDQYWGIGSLASGINLFTNSFEGPVLDHRYYAGGCSPHYILNTRFRKPYNVESYTPQTQGKYEFILKEYESYSDFERNVTEKMASKSGFSFGFKIPGIFELGISSQSDRGKHYIRRTKRFSHTKSVFLHARSDLEVAHYKLKPRSLMLHYEFLQRVKRLPLEYSYGEYRDLFRDFGTHYITEAVLGGIYEYTLVMNKEAMERGDYTLNNVHACAKNDFKIGGAIEEVYVSLGVSVGKCRGILNEIKDRNKRDTMVEDLVVLVRGGASEHITTLAYQELPTADLMQEWGDAVQYNPAIIKVKVEPLYELVTATDFAYSSTVRQNMKQALEEFQKEVSSCHCAPCQGNGVPVLKGSRCDCICPVGSQGLACEVSYRKNTPIDGKWNCWSNWSSCSGRRKTRQRQCNNPPPQNGGSPCSGPASETLDCS |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | C8B complement component 8, beta polypeptide [ Homo sapiens ] |
Official Symbol | C8B |
Synonyms | C8B; complement component 8, beta polypeptide; complement component C8 beta chain; complement component 8 subunit beta; MGC163447; |
Gene ID | 732 |
mRNA Refseq | NM_000066 |
Protein Refseq | NP_000057 |
MIM | 120960 |
UniProt ID | P07358 |
◆ Recombinant Proteins | ||
C8b-6787M | Recombinant Mouse C8b protein, His & T7-tagged | +Inquiry |
C8b-6788R | Recombinant Rat C8b protein, His & T7-tagged | +Inquiry |
C8B-8192Z | Recombinant Zebrafish C8B | +Inquiry |
C8b-469M | Recombinant Mouse C8b Protein, MYC/DDK-tagged | +Inquiry |
C8B-1903HFL | Recombinant Full Length Human C8B Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C8B-7955HCL | Recombinant Human C8B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C8B Products
Required fields are marked with *
My Review for All C8B Products
Required fields are marked with *
0
Inquiry Basket