Recombinant Human C8G protein, His-SUMO-tagged
| Cat.No. : | C8G-2613H |
| Product Overview : | Recombinant Human C8G protein(P07360)(21-202aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 21-202aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 36.4 kDa |
| AA Sequence : | QKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARDARGAVHVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQFHVLDEVRR |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | C8G complement component 8, gamma polypeptide [ Homo sapiens ] |
| Official Symbol | C8G |
| Synonyms | C8G; complement component 8, gamma polypeptide; complement component C8 gamma chain; C8C; MGC142186; |
| Gene ID | 733 |
| mRNA Refseq | NM_000606 |
| Protein Refseq | NP_000597 |
| MIM | 120930 |
| UniProt ID | P07360 |
| ◆ Recombinant Proteins | ||
| C8G-0583H | Recombinant Human C8G Protein (Lys39-Arg202), N-GST-tagged | +Inquiry |
| C8G-4234H | Recombinant Human C8G protein, His-tagged | +Inquiry |
| C8G-11112Z | Recombinant Zebrafish C8G | +Inquiry |
| C8G-6880H | Recombinant Human Complement Component 8, Gamma Polypeptide, His-tagged | +Inquiry |
| C8G-2613H | Recombinant Human C8G protein, His-SUMO-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| C8G-130HCL | Recombinant Human C8G lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C8G Products
Required fields are marked with *
My Review for All C8G Products
Required fields are marked with *



