Recombinant Human C8G protein, His-SUMO-tagged
| Cat.No. : | C8G-2613H | 
| Product Overview : | Recombinant Human C8G protein(P07360)(21-202aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His&SUMO | 
| Protein Length : | 21-202aa | 
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. | 
| Molecular Mass : | 36.4 kDa | 
| AA Sequence : | QKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARDARGAVHVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQFHVLDEVRR | 
| Purity : | Greater than 90% as determined by SDS-PAGE. | 
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | 
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. | 
| Gene Name | C8G complement component 8, gamma polypeptide [ Homo sapiens ] | 
| Official Symbol | C8G | 
| Synonyms | C8G; complement component 8, gamma polypeptide; complement component C8 gamma chain; C8C; MGC142186; | 
| Gene ID | 733 | 
| mRNA Refseq | NM_000606 | 
| Protein Refseq | NP_000597 | 
| MIM | 120930 | 
| UniProt ID | P07360 | 
| ◆ Recombinant Proteins | ||
| C8G-6880H | Recombinant Human Complement Component 8, Gamma Polypeptide, His-tagged | +Inquiry | 
| C8G-2043H | Recombinant Human C8G protein, His & GST-tagged | +Inquiry | 
| C8G-2788H | Recombinant Human C8G Protein, His-tagged | +Inquiry | 
| C8G-11112Z | Recombinant Zebrafish C8G | +Inquiry | 
| C8G-0156H | Recombinant Human C8G Protein, His-Tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| C8G-130HCL | Recombinant Human C8G lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C8G Products
Required fields are marked with *
My Review for All C8G Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            