Recombinant Human C8G Protein, His tagged

• Cat.No.: C8G-0156H
• Product Overview: Recombinant Human C8G Protein with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 21-202 aa
• Description: The protein encoded by this gene belongs to the lipocalin family. It is one of the three subunits that constitutes complement component 8 (C8), which is composed of a disulfide-linked C8 alpha-gamma heterodimer and a non-covalently associated C8 beta chain. C8 participates in the formation of the membrane attack complex (MAC) on bacterial cell membranes. While subunits alpha and beta play a role in complement-mediated bacterial killing, the gamma subunit is not required for the bactericidal activity.
• Form: Sterile PBS, pH7.4, 0.5% SKL
• Molecular Mass: 22 kDa
• AASequence: MGSSHHHHHHSSGLVPRGSHMQKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARGARGAVHVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQFHVLDEVRR
• Endotoxin: < 1 EU/μg by LAL
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1 mg/mL by BCA

Gene Information

• Gene Name: C8G complement component 8, gamma polypeptide [ Homo sapiens (human) ]
• Official Symbol: C8G
• Synonyms: C8G; complement component 8, gamma polypeptide; complement component C8 gamma chain; C8C; MGC142186
• Gene ID: 733
• mRNA Refseq: NM_000606
• Protein Refseq: NP_000597
• MIM: 120930
• UniProt ID: P07360