Recombinant Human C8orf37 Protein, GST-Tagged

• Cat.No.: C8orf37-0161H
• Product Overview: Human C8orf37 full-length ORF (NP_808880.1, 1 a.a. - 207 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a ubiquitously expressed protein of unknown function. It has high levels of mRNA expression in the brain, heart, and retina and the protein co-localizes with polyglutamylated tubulin at the base of the primary cilium in human retinal pigment epithelial cells. Mutations in this gene have been associated with autosomal recessive cone-rod dystrophy (arCRD) and retinitis pigmentosa (arRP). [provided by RefSeq, Mar 2012]
• Molecular Mass: 49.8 kDa
• AA Sequence: MAEDLDELLDEVESKFCTPDLLRRGMVEQPKGCGGGTHSSDRNQAKAKETLRSTETFKKEDDLDSLINEILEEPNLDKKPSKLKSKSSGNTSVRASIEGLGKSCSPVYLGGSSIPCGIGTNISWRACDHLRCIACDFLVVSYDDYMWDKSCDYLFFRNNMPEFHKLKAKLIKKKGTRAYACQCSWRTIEEVTDLQTDHQLRWVCGKH
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C8orf37 chromosome 8 open reading frame 37 [ Homo sapiens (human) ]
• Official Symbol: C8orf37
• Synonyms: C8orf37; chromosome 8 open reading frame 37; RP64; BBS21; CORD16; smalltalk; protein C8orf37; Chromosome 8 Open Reading Frame 37; Smalltalk; Protein C8orf37; CORD16; BBS21; RP64
• Gene ID: 157657
• mRNA Refseq: NM_177965
• Protein Refseq: NP_808880
• MIM: 614477
• UniProt ID: Q96NL8