Recombinant Human C9, GST-tagged
Cat.No. : | C9-26247TH |
Product Overview : | Recombinant Human C9 full-length ORF (22 a.a. - 559 a.a) fussed with GST tag at N-terminal was expressed in Wheat Germ. |
Availability | June 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | His |
Description : | This gene encodes the final component of the complement system. It participates in the formation of the Membrane Attack Complex (MAC).The MAC assembles on bacterial membranes to form a pore, permitting disruption of bacterial membrane organization. Mutations in this gene cause component C9 deficiency. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 84.92 kDa |
AA Sequence : | QYTTSYDPELTESSGSASHIDCRMSPWSEWSQCDPCLRQMFRSRSIEVFGQFNGKRCTDAVGDRRQCVPTEPCED AEDDCGNDFQCSTGRCIKMRLRCNGDNDCGDFSDEDDCESEPRPPCRDRVVEESELARTAGYGINILGMDPLSTP FDNEFYNGLCNRDRDGNTLTYYRRPWNVASLIYETKGEKNFRTEHYEEQIEAFKSIIQEKTSNFNAAISLKFTPT ETNKAEQCCEETASSISLHGKGSFRFSYSKNETYQLFLSYSSKKEKMFLHVKGEIHLGRFVMRNRDVVLTTTFVD DIKALPTTYEKGEYFAFLETYGTHYSSSGSLGGLYELIYVLDKASMKRKGVELKDIKRCLGYHLDVSLAFSEISV GAEFNKDDCVKRGEGRAVNITSENLIDDVVSLIRGGTRKYAFELKEKLLRGTVIDVTDFVNWASSINDAPVLISQ KLSPIYNLVPVKMKNAHLKKQNLERAIEDYINEFSVRKCHTCQNGGTVILMDGKCLCACPFKFEGIACEISKQKI SEGLPALEFPNEK |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | C9 complement component 9 [ Homo sapiens ] |
Official Symbol | C9 |
Synonyms | C9D; ARMD15; complement component C9 |
Gene ID | 735 |
mRNA Refseq | NM_001737 |
Protein Refseq | NP_001728 |
MIM | 120940 |
UniProt ID | P02748 |
Chromosome Location | 5p14-p12 |
Pathway | Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Complement Activation, Classical Pathway, organism-specific biosystem |
◆ Recombinant Proteins | ||
C9-1056R | Recombinant Rat C9 Protein | +Inquiry |
C9-04R | Recombinant Rat C9 Protein | +Inquiry |
C9-05M | Recombinant Mouse C9 Protein | +Inquiry |
C9-0274H | Recombinant Human C9 Protein (Gln22-His265), N-His-tagged | +Inquiry |
C9-5126H | Recombinant Human C9, His-tagged | +Inquiry |
◆ Native Proteins | ||
C9-58H | Native Human Complement C9 | +Inquiry |
◆ Cell & Tissue Lysates | ||
C9-7945HCL | Recombinant Human C9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C9 Products
Required fields are marked with *
My Review for All C9 Products
Required fields are marked with *
0
Inquiry Basket