Recombinant Human C9orf116 Protein, GST-Tagged

Cat.No. : C9orf116-0181H
Product Overview : Human C9orf116 full-length ORF (AAH21261.1, 1 a.a. - 92 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : C9orf116 (Chromosome 9 Open Reading Frame 116) is a Protein Coding gene.
Molecular Mass : 36.52 kDa
AA Sequence : MAEECPRACAEPVAPKATAPPERTSDYYRVSADLPGRFNNPGWFRGYRTQKAVSVYRTSNQAYGSRAPTVHEMPRVECSGTILSMFTWRKAS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C9orf116 chromosome 9 open reading frame 116 [ Homo sapiens ]
Official Symbol C9orf116
Synonyms PIERCE1; RbEST47; RP11-426A6.4
Gene ID 138162
mRNA Refseq NM_144654
Protein Refseq NP_653255
MIM 614502
UniProt ID Q5BN46

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C9orf116 Products

Required fields are marked with *

My Review for All C9orf116 Products

Required fields are marked with *

0
cart-icon
0
compare icon