Recombinant Human C9orf116 Protein, GST-Tagged

• Cat.No.: C9orf116-0181H
• Product Overview: Human C9orf116 full-length ORF (AAH21261.1, 1 a.a. - 92 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: C9orf116 (Chromosome 9 Open Reading Frame 116) is a Protein Coding gene.
• Molecular Mass: 36.52 kDa
• AA Sequence: MAEECPRACAEPVAPKATAPPERTSDYYRVSADLPGRFNNPGWFRGYRTQKAVSVYRTSNQAYGSRAPTVHEMPRVECSGTILSMFTWRKAS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C9orf116 chromosome 9 open reading frame 116 [ Homo sapiens ]
• Official Symbol: C9orf116
• Synonyms: PIERCE1; RbEST47; RP11-426A6.4
• Gene ID: 138162
• mRNA Refseq: NM_144654
• Protein Refseq: NP_653255
• MIM: 614502
• UniProt ID: Q5BN46