Recombinant Human C9orf16 Protein, GST-Tagged
Cat.No. : | C9orf16-0190H |
Product Overview : | Human C9orf16 full-length ORF (BAG38107.1, 1 a.a. - 83 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | C9orf16 (Chromosome 9 Open Reading Frame 16) is a Protein Coding gene. |
Molecular Mass : | 35.53 kDa |
AA Sequence : | MSGPNGDLGMPVEAGAEGEEDGFGEAEYAAINSMLDQINSCLDHLEEKNDHLHARLQELLESNRQTRLEFQQQLGEAPSDASP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | C9orf16 chromosome 9 open reading frame 16 [ Homo sapiens ] |
Official Symbol | C9orf16 |
Synonyms | EST00098 |
Gene ID | 79095 |
mRNA Refseq | NM_024112 |
Protein Refseq | NP_077017 |
UniProt ID | Q9BUW7 |
◆ Recombinant Proteins | ||
C9orf16-10602H | Recombinant Human C9orf16, His-tagged | +Inquiry |
C9orf16-0190H | Recombinant Human C9orf16 Protein, GST-Tagged | +Inquiry |
C9orf16-2692HF | Recombinant Full Length Human C9orf16 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C9orf16-7939HCL | Recombinant Human C9orf16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C9orf16 Products
Required fields are marked with *
My Review for All C9orf16 Products
Required fields are marked with *