Recombinant Human C9orf43 Protein, GST-Tagged

• Cat.No.: C9orf43-0202H
• Product Overview: Human C9orf43 full-length ORF (NP_689999.1, 1 a.a. - 461 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: C9orf43 (Chromosome 9 Open Reading Frame 43) is a Protein Coding gene.
• Molecular Mass: 78.6 kDa
• AA Sequence: MDLPDESQWDETTCGLAVCQHPQCWATIRRIERGHPRILGSSCKTPLDAEDKLPVLTVVDILDSGFAAHHLPECTFTKAHSLLSQSSKFYSKFHGRPPKGLPDKSLINCTNRLPKFPVLNLNETQLPCPEDVRNMVVLWIPEETEIHVSQHGKKKRKNSAVKSKSFLGLSGNQSAGTRVGTPGMIVPPPTPVQLSEQFSSDFLPLWAQSEALPQDLLKELLPGGKQTMLCPEMKIKLAMMKKNLPLEKNRPDSVISSKMFLSIHRLTLERPALRYPERLKKLHNLKTEGYRKQQQRQQQQQQQQKKVKTPIKKQEAKKKAKSDPGIQSTSHKHPVTTVHDRLYGYRTLPGQNSDMKQQQQMEKGTTSKQDSTERPKMNYYDHADFHHSVKSPELYETEPTNKDISAPVDAVPEAQAARQKKISFNFSEIMASTGWNSELKLLRILQDTDDEDEEDQSSGAE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C9orf43 chromosome 9 open reading frame 43 [ Homo sapiens ]
• Official Symbol: C9orf43
• Synonyms: C9ORF43; chromosome 9 open reading frame 43; uncharacterized protein C9orf43; MGC17358
• Gene ID: 257169
• mRNA Refseq: NM_152786
• Protein Refseq: NP_689999
• UniProt ID: Q8TAL5