Recombinant Human C9orf62 Protein, GST-Tagged
Cat.No. : | C9orf62-0207H |
Product Overview : | Human C9orf62 full-length ORF (AAH34752.1, 1 a.a. - 152 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | C9orf62 (Chromosome 9 Open Reading Frame 62) is a Protein Coding gene. |
Molecular Mass : | 43.1 kDa |
AA Sequence : | MGLSPGQTSVSFLWPLLEVRDHNTGRGLVPATVLTPGSPETLLELRQAFLGSRQARHGHDAAPSSGQQGCSVDRTAGRPVLGWRLRNSLTGQEGRQHLHLSGIRTSRKAKEYKPVFFGATEISVLMAVAESLREPPPPQWGWFLSSLFLKIF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | C9orf62 chromosome 9 open reading frame 62 [ Homo sapiens (human) ] |
Official Symbol | C9orf62 |
Synonyms | C9orf62; chromosome 9 open reading frame 62; putative uncharacterized protein C9orf62; Chromosome 9 Open Reading Frame 62 |
Gene ID | 157927 |
mRNA Refseq | NM_173520 |
Protein Refseq | NP_775791 |
UniProt ID | Q8N4C0 |
◆ Recombinant Proteins | ||
C9orf62-2718HF | Recombinant Full Length Human C9orf62 Protein, GST-tagged | +Inquiry |
C9orf62-0207H | Recombinant Human C9orf62 Protein, GST-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C9orf62 Products
Required fields are marked with *
My Review for All C9orf62 Products
Required fields are marked with *