Recombinant Human CA1 Protein, GST-Tagged
Cat.No. : | CA1-0227H |
Product Overview : | Human CA1 full-length ORF (AAH27890, 1 a.a. - 261 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. This CA1 gene is closely linked to the CA2 and CA3 genes on chromosome 8. It encodes a cytosolic protein that is found at the highest level in erythrocytes. Allelic variants of this gene have been described in some populations. Alternative splicing and the use of alternative promoters results in multiple transcript variants. [provided by RefSeq, Nov 2016] |
Molecular Mass : | 54.45 kDa |
AA Sequence : | MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CA1 carbonic anhydrase I [ Homo sapiens ] |
Official Symbol | CA1 |
Synonyms | CA1; carbonic anhydrase I; carbonic anhydrase 1; Car1; carbonic anhydrase B; carbonic dehydratase; carbonate dehydratase I; CAB; CA-I; |
Gene ID | 759 |
mRNA Refseq | NM_001128829 |
Protein Refseq | NP_001122301 |
MIM | 114800 |
UniProt ID | P00915 |
◆ Recombinant Proteins | ||
CA1-2731HF | Recombinant Full Length Human CA1 Protein, GST-tagged | +Inquiry |
CA1-6515H | Recombinant Human CA1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CA1-10612H | Recombinant Human CA1, GST-tagged | +Inquiry |
CA1-1677H | Recombinant Human Carbonic Anhydrase I, His-tagged | +Inquiry |
CA1-375R | Recombinant Rat CA1 Protein (2-261 aa), His-SUMO-tagged | +Inquiry |
◆ Native Proteins | ||
CA1-2505H | Active Recombinant Full Length Human CA1 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CA1-7917HCL | Recombinant Human CA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CA1 Products
Required fields are marked with *
My Review for All CA1 Products
Required fields are marked with *